DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GSTT1 and GstE5

DIOPT Version :9

Sequence 1:NP_000844.2 Gene:GSTT1 / 2952 HGNCID:4641 Length:240 Species:Homo sapiens
Sequence 2:NP_611327.1 Gene:GstE5 / 37110 FlyBaseID:FBgn0063495 Length:222 Species:Drosophila melanogaster


Alignment Length:230 Identity:63/230 - (27%)
Similarity:110/230 - (47%) Gaps:27/230 - (11%)


- Green bases have known domain annotations that are detailed below.


Human     3 LELYLDLLSQPCRAVYIFAKKNDIPFELRIVDLIKGQHLSDAFAQVNPLKKVPALKDGDFTLTES 67
            |.||....|.|.|||.:......:|:|...|::...:.||:.:.:.||...||.|:|....:.:|
  Fly     4 LTLYGVNPSPPVRAVKLTLAALQLPYEFVNVNISGQEQLSEEYLKKNPEHTVPTLEDDGNYIWDS 68

Human    68 VAILLYLTRKYKVPDYWYPQDLQARARVDEYLAWQHTTLRRSCLRALWHKVMFPVFLGEPVSPQT 132
            .||:.||..||...|..||:||..||.||:.|.::...:..:.::|: .|.:|  |.|....|: 
  Fly    69 HAIIAYLVSKYADSDALYPRDLLQRAVVDQRLHFETGVVFANGIKAI-TKPLF--FNGLNRIPK- 129

Human   133 LAATLAELDVTLQLLE--DKFLQNKAFLTGPHISLAD---LVAITELMHPVGAGCQVFEGRPKLA 192
                 ...|..:::.:  :.||....::.|..:::||   :.:||.|:..|......:   |::.
  Fly   130 -----ERYDAIVEIYDFVETFLAGHDYIAGDQLTIADFSLISSITSLVAFVEIDRLKY---PRII 186

Human   193 TWRQRVEAAVGEDLFQEAH-------EVILKAKDF 220
            .|.:|:|..   ..::||:       |.|||:.:|
  Fly   187 EWVRRLEKL---PYYEEANAKGARELETILKSTNF 218

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GSTT1NP_000844.2 GST_N_Theta 3..78 CDD:239348 24/74 (32%)