DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GSTT1 and GstE3

DIOPT Version :9

Sequence 1:NP_000844.2 Gene:GSTT1 / 2952 HGNCID:4641 Length:240 Species:Homo sapiens
Sequence 2:NP_611325.2 Gene:GstE3 / 37108 FlyBaseID:FBgn0063497 Length:220 Species:Drosophila melanogaster


Alignment Length:224 Identity:72/224 - (32%)
Similarity:109/224 - (48%) Gaps:32/224 - (14%)


- Green bases have known domain annotations that are detailed below.


Human    11 SQPCRAVYIFAKKNDIPFELRIVDLIKGQHLSDAFAQVNPLKKVPALKDGDFTLTESVAILLYLT 75
            |.|.|:|.:..:..::.|:.:||:|::.:||...|.::|||..||||.|..|.|.:|.||..||.
  Fly    12 SPPVRSVLLTLRALNLDFDYKIVNLMEKEHLKPEFLKINPLHTVPALDDNGFYLADSHAINSYLV 76

Human    76 RKYKVPDYWYPQDLQARARVDEYLAWQHTTLRRSCLRALWHKVMFPVFLGEPVS-PQTLAATLAE 139
            .||...|..||:||:.||.||:.|.:.     .|.:.:....:.||:|...... ||.....|..
  Fly    77 SKYGRNDSLYPKDLKKRAIVDQRLHYD-----SSVVTSTGRAITFPLFWENKTEIPQARIDALEG 136

Human   140 LDVTLQLLEDKFLQNKAFLTGPHISLADLVAITELMHPVGAGCQVF-----EGRPKLATWRQRV- 198
            :..:|.|    ||:|..:|.|.::::||...|..|     .|..||     ...|:||.|.:|: 
  Fly   137 VYKSLNL----FLENGNYLAGDNLTIADFHVIAGL-----TGFFVFLPVDATKYPELAAWIKRIK 192

Human   199 -----EAAVGEDLFQEAHEVI--LKAKDF 220
                 |.|.|    ..|.::|  :|:|.|
  Fly   193 ELPYYEEANG----SRAAQIIEFIKSKKF 217

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GSTT1NP_000844.2 GST_N_Theta 3..78 CDD:239348 26/66 (39%)