DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GSTT1 and GstE14

DIOPT Version :9

Sequence 1:NP_000844.2 Gene:GSTT1 / 2952 HGNCID:4641 Length:240 Species:Homo sapiens
Sequence 2:NP_610855.1 Gene:GstE14 / 36467 FlyBaseID:FBgn0033817 Length:232 Species:Drosophila melanogaster


Alignment Length:251 Identity:67/251 - (26%)
Similarity:110/251 - (43%) Gaps:51/251 - (20%)


- Green bases have known domain annotations that are detailed below.


Human     5 LYLDLLSQPCRAVYIFAKKNDIPFELRIVDLIKGQHLSDAFAQVNPLKKVPALKDGDFTLTESVA 69
            ||.|..|.|.|:..:..|..||..|||.|:|.||:.....|..:||...||.|..||..||:|.|
  Fly     8 LYYDERSPPVRSCLMLIKLLDIDVELRFVNLFKGEQFQKDFLALNPQHSVPTLVHGDLVLTDSHA 72

Human    70 ILLYLTRKYKVPDYWYPQDLQARARVDEYLAWQHTTLRRSCLRALWHKVMFPVFLGEPVSPQTLA 134
            ||::|..|:......:||:...|.:|...|.::.:.|.|.                   ....::
  Fly    73 ILIHLAEKFDEGGSLWPQEHAERMKVLNLLLFECSFLFRR-------------------DSDFMS 118

Human   135 ATL----AELDVT--------LQLLEDKFLQNKAFLTGPHISLADLVAIT-----ELMHPVGAGC 182
            ||:    |.:||.        ..::.:::|:|..|:.||.::||||..:|     .||.|:..  
  Fly   119 ATVRQGFANVDVAHHERKLTEAYIIMERYLENSDFMAGPQLTLADLSIVTTLSTVNLMFPLSQ-- 181

Human   183 QVFEGRPKLATW---RQRVEA----AVGEDLFQEAHEVILKAKDFPPADPTIKQKL 231
                 .|:|..|   .|:::|    ..|.:..::..|.: .:..||.:...:.:|:
  Fly   182 -----FPRLRRWFTAMQQLDAYEANCSGLEKLRQTMESV-GSFQFPSSSAVVTEKV 231

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GSTT1NP_000844.2 GST_N_Theta 3..78 CDD:239348 31/72 (43%)