DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GSTT1 and GstT1

DIOPT Version :9

Sequence 1:NP_000844.2 Gene:GSTT1 / 2952 HGNCID:4641 Length:240 Species:Homo sapiens
Sequence 2:NP_610509.2 Gene:GstT1 / 35995 FlyBaseID:FBgn0050000 Length:228 Species:Drosophila melanogaster


Alignment Length:219 Identity:79/219 - (36%)
Similarity:118/219 - (53%) Gaps:10/219 - (4%)


- Green bases have known domain annotations that are detailed below.


Human     3 LELYLDLLSQPCRAVYIFAKKNDIPFELRIVDLIKGQHLSDAFAQVNPLKKVPALKDGDFTLTES 67
            ::.|.|.||||.||::|..|....|||...|.|.|.:.|:|.:..:|..:||||:.||.|.|.||
  Fly     5 IKYYYDFLSQPSRALWIAMKLGKTPFEDCPVALRKQEQLTDEYRSINRFQKVPAIVDGKFQLGES 69

Human    68 VAILLYLTRKYKVPDYWYPQDLQARARVDEYLAWQHTTLRRSC---LRALWHKVMFPV-FLGEPV 128
            |:|:.||..|....:..||:.|:.||||||:|.|||..:|..|   .|.:|   :.|. .|....
  Fly    70 VSIVRYLADKGVFSEQLYPKTLEERARVDEFLEWQHFNVRLVCSLFFRQVW---LLPAKGLAPAP 131

Human   129 SPQTLAATLAELDVTLQLLEDKFLQNKAFLTGPHISLADLVAITELMHPVGAGCQVFEGR-PKLA 192
            .|:::...:.:::..|.|||..:|: |.||.|..:::||:...:|:.........|.|.: ||:|
  Fly   132 KPESVKKLIKDVESNLGLLERLWLE-KDFLVGDKLTVADIFGSSEINQMKLCQYNVNEKQFPKVA 195

Human   193 TWRQRVEAAVGEDLFQEAHEVILK 216
            .|.:||..|. ...:.|||..:.|
  Fly   196 KWMERVRDAT-NPYYDEAHSFVYK 218

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GSTT1NP_000844.2 GST_N_Theta 3..78 CDD:239348 33/74 (45%)