DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mapk13 and rl

DIOPT Version :9

Sequence 1:NP_062104.3 Gene:Mapk13 / 29513 RGDID:3045 Length:366 Species:Rattus norvegicus
Sequence 2:NP_001015122.1 Gene:rl / 3354888 FlyBaseID:FBgn0003256 Length:376 Species:Drosophila melanogaster


Alignment Length:338 Identity:149/338 - (44%)
Similarity:219/338 - (64%) Gaps:9/338 - (2%)


- Green bases have known domain annotations that are detailed below.


  Rat    19 WELPKTYLAPAHVGSGAYGAVCSAIDKRTGEKVAIKKLSRPFQSEIFAKRAYRELLLLKHMHHEN 83
            :|:...|:..|::|.||||.|.||.|..|.::|||||:| ||:.:.:.:|..||:.:|....|||
  Fly    32 FEVGPRYIKLAYIGEGAYGMVVSADDTLTNQRVAIKKIS-PFEHQTYCQRTLREITILTRFKHEN 95

  Rat    84 VIGLLDVYTPATSVRNFQDFYLVMPFMQTDLQKIMGME-FSEEKVQYLVYQMLKGLKYIHSAGIV 147
            :|.:.|:.. ..|:...:|.|:|...|:|||.|::..: .|.:.:.|.:||:|:||||||||.::
  Fly    96 IIDIRDILR-VDSIDQMRDVYIVQCLMETDLYKLLKTQRLSNDHICYFLYQILRGLKYIHSANVL 159

  Rat   148 HRDLKPGNLAVNEDCELKILDFGLARHTDAE------MTGYVVTRWYRAPEVILSWMHYNQTVDI 206
            ||||||.||.:|:.|:|||.||||||..|.|      :|.||.||||||||::|:...|.:::||
  Fly   160 HRDLKPSNLLLNKTCDLKICDFGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDI 224

  Rat   207 WSVGCIMAEMLTGKTLFKGKDYLDQLTQILKVTGVPGAEFVQKLKDKAAKSYIQSLPQSPKKDFT 271
            ||||||:||||:.:.:|.||.|||||..||.|.|.|..:.::.:.::.|::|::|||..|...:.
  Fly   225 WSVGCILAEMLSNRPIFPGKHYLDQLNHILGVLGSPSRDDLECIINEKARNYLESLPFKPNVPWA 289

  Rat   272 QLFPRASPQAVDLLDKMLELDVDKRLTAAQALAHPFFEPFRDPEEETEAQQPFDDALEREKLSVD 336
            :|||.|...|:|||.|||..:..||:...:|||||:.|.:.||.:|..|:.||...:|.:.:|.|
  Fly   290 KLFPNADALALDLLGKMLTFNPHKRIPVEEALAHPYLEQYYDPGDEPVAEVPFRINMENDDISRD 354

  Rat   337 EWKQHIYKEIANF 349
            ..|..|::|...|
  Fly   355 ALKSLIFEETLKF 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mapk13NP_062104.3 STKc_p38delta 9..351 CDD:143384 149/338 (44%)
TXY 180..182 1/1 (100%)
rlNP_001015122.1 STKc_ERK1_2_like 32..366 CDD:270839 148/335 (44%)
S_TKc 38..326 CDD:214567 134/289 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0660
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.