DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Slc22a6 and CG31103

DIOPT Version :9

Sequence 1:NP_058920.1 Gene:Slc22a6 / 29509 RGDID:69338 Length:551 Species:Rattus norvegicus
Sequence 2:NP_001097914.1 Gene:CG31103 / 43030 FlyBaseID:FBgn0051103 Length:506 Species:Drosophila melanogaster


Alignment Length:437 Identity:84/437 - (19%)
Similarity:174/437 - (39%) Gaps:85/437 - (19%)


- Green bases have known domain annotations that are detailed below.


  Rat   142 MVGVLLGAMVFGYLADRLGRRKVLIL-NYLQTAVSGTCAAYAPNYTVYCVFRLLSGMSLA----- 200
            :.|:.|...::||::|.:|||:||:. |:...|:. ....:..:..::.:..||.|:|:.     
  Fly    77 VTGIFLSTYIWGYISDDIGRRRVLLYGNFASNALQ-FVLMFVTSVWLFNIINLLVGISVGAVSAA 140

  Rat   201 --------------SIAINCMTLNVEWMPIHTRAYVGTLI--GYVYSLGQFLLAGIAYAVPHWRH 249
                          ::|||..|:.|....|:..|....::  .:..::|.|:..       .||.
  Fly   141 LYAYLSEFNIPRHRAVAINYSTMFVSVTAIYVPATAWLVLSSNWAITMGDFVFR-------PWRL 198

  Rat   250 LQLVVSVPFFIAFIYSWFFIESARWYSSSGRLDLTLRALQRVARIN-GKQ-------EEGAKLSI 306
            |.||..:|.||..:...::.||.::..|..:.:..:.|:..:::.| ||.       :|....|.
  Fly   199 LLLVSLLPGFIGGLILLYYPESPKFLLSQEKNNEAIEAVAWISKFNRGKSIQQVLSCDEFTLKSE 263

  Rat   307 EVLRTSLQKEL----TLSKGQASAMELLRCPTLRHLFLCLSMLWFATSFAYYGL----------- 356
            :.:..:|..|.    .|||...:.:.|...|...:..|| ::..|...|:..|:           
  Fly   264 DPVGENLLGESQGCGILSKICRATIPLFHKPHGFNFILC-NLALFGMFFSSNGMQLWFPEIVNRS 327

  Rat   357 ---------VMDLQGFGVSM-----------------YLIQVIFGAVDLPAKFVCFLVINSMGRR 395
                     |.::....|..                 |:..::.|...|....:..|::|.:||:
  Fly   328 SGAENNSSTVCEILSVPVEQPNVTETLDCTDPISSKTYIDNLVVGFAFLIGFSIQGLILNPLGRK 392

  Rat   396 PAQMASLLLAGIC-ILVNGIIPKSHTIIRTSLAVLGKGCLASSFNCIFLYTGELYPTVIRQTGLG 459
            ...:|:|.:|.:. :|::.:...:..::...|.:|..|.   |.:.:.....:|.||.:|...:.
  Fly   393 NVLLAALAVATLSGVLLHFMESPTGVLVLFCLYILLPGL---SISIMIGAIVDLVPTHLRSKAVS 454

  Rat   460 MGSTMARVGSIVSP-LVSMTAEFYPSMPLFIFGAVPVVASAVTALLP 505
            ...::.|:|.|.:. |:.:..:.|.:....:|....:|...:...||
  Fly   455 FCMSLGRLGIIAATNLMGVMLQPYCNTTFAMFTCTLIVCIVIVHYLP 501

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Slc22a6NP_058920.1 2A0119 11..515 CDD:273328 84/437 (19%)
MFS 135..505 CDD:119392 82/435 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 514..551
CG31103NP_001097914.1 2A0115 29..475 CDD:273327 79/409 (19%)
MFS 34..>189 CDD:119392 23/112 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166346996
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.