DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Slc22a6 and CG33233

DIOPT Version :9

Sequence 1:NP_058920.1 Gene:Slc22a6 / 29509 RGDID:69338 Length:551 Species:Rattus norvegicus
Sequence 2:NP_995978.2 Gene:CG33233 / 2769005 FlyBaseID:FBgn0053233 Length:489 Species:Drosophila melanogaster


Alignment Length:494 Identity:92/494 - (18%)
Similarity:180/494 - (36%) Gaps:126/494 - (25%)


- Green bases have known domain annotations that are detailed below.


  Rat   101 VTEPCIDGWVYDNSTFPSTIVTEWNLVCSHRAFRQLAQSLYMVGVLLGAMVFGYLADRLGRRKVL 165
            |||....|::        .::|......|.:....||.|| :.|::...:..|:||||.||:.|:
  Fly    34 VTESMTAGYL--------VVLTSCEFDTSPKEKTLLANSL-LGGMVASGLFIGFLADRYGRKFVI 89

  Rat   166 ILNYLQTAVSGTCAAYAPNYTVYCVFRLLSGMSLASIAINCMTLNV---------EWMPIHTRAY 221
            .|..:........:|..|:.....|.|::.|..|:::|    :|.|         :|.|| |.|.
  Fly    90 RLALVGALSFSVISALMPDLYSLSVIRIIVGTFLSAVA----SLQVGFLGEFHAIKWRPI-TVAI 149

  Rat   222 V----GTLIGYVYSLGQFLL-------AGIAYAVPHWRHLQLVVSVPFFIAFIYSWFFIESARWY 275
            .    |..:.|...:...:|       ...:|.:..||.|.:...:|.::|.:......|:..:.
  Fly   150 CSQSQGLALIYCPLVAMAILPNNFNVDLSSSYNLRVWRFLMMFFMIPGWLALVGICLVPETPHFL 214

  Rat   276 SSSGRLDLTLRALQRVARINGKQEEGAKLSIEVLRTSLQKELTLSKGQASAME------------ 328
            .|..|.|..|.||:.:.|:|.|:.|..             ::|||:.::|..:            
  Fly   215 MSVNRPDKALLALKWICRMNRKKWEDV-------------DITLSEEKSSTNDQEGFWKTVWYEY 266

  Rat   329 --LLRCPTLRHLFLCLSMLW--FATSFA---YYGLVMDLQGFG---------------------- 364
              |...|.:...|:||.:::  |.||..   ::.::.::...|                      
  Fly   267 KLLFSKPHVFKFFICLFLIFGIFFTSIGLGIWFPVIRNMDNSGSNRLCDLVNNNPTFINHEADDT 331

  Rat   365 -------------VSMYLIQVIFGAVDLPAKFVCFLVINSMGRRPAQMASLLLAGICILVNGIIP 416
                         ::..:..|.:|...:....:..::::.|.|:       .:..:.||::.|:.
  Fly   332 NGTDSESPKCNDEMTNLIDPVYYGFTYIGCFILASVLVHWMTRK-------YVIALHILISMILG 389

  Rat   417 KSHTIIRTSLAVLGKGCLASSFNCIFLYTGELYPTV-----------IRQTGLGMGSTMARVGSI 470
            .|..|::....||      ..|..:.:..|.|.|..           :|...|.|..::||.|.:
  Fly   390 ISLNIMKQPTVVL------IFFVLMMVLPGVLIPLATSVLVDCLPVNLRGKALCMVRSLARFGGV 448

  Rat   471 V-SPLVSMTAEFYPSMPLFIFGAVPVVASAVTALLPETL 508
            : |.::.:.......:...||.....:...:....|:.:
  Fly   449 LGSTMIGLFIRVTCDVTFNIFNLCLAICVVLAVFQPKDI 487

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Slc22a6NP_058920.1 2A0119 11..515 CDD:273328 92/494 (19%)
MFS 135..505 CDD:119392 85/455 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 514..551
CG33233NP_995978.2 MFS_1 22..451 CDD:284993 88/456 (19%)
MFS 23..>208 CDD:119392 43/187 (23%)
MFS 354..>482 CDD:304372 23/140 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166346990
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.