DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Slc22a2 and CG31103

DIOPT Version :9

Sequence 1:NP_113772.1 Gene:Slc22a2 / 29503 RGDID:61936 Length:593 Species:Rattus norvegicus
Sequence 2:NP_001097914.1 Gene:CG31103 / 43030 FlyBaseID:FBgn0051103 Length:506 Species:Drosophila melanogaster


Alignment Length:451 Identity:105/451 - (23%)
Similarity:179/451 - (39%) Gaps:122/451 - (27%)


- Green bases have known domain annotations that are detailed below.


  Rat   159 GFFIGAMMIGYLADRFGRKFCLLV-TILINAISGALMAISPNYAWML-VFRFLQGLVSKAGWLIG 221
            |.|:...:.||::|..||:..||. ....||:...||.::.  .|:. :...|.|:...|.....
  Fly    79 GIFLSTYIWGYISDDIGRRRVLLYGNFASNALQFVLMFVTS--VWLFNIINLLVGISVGAVSAAL 141

  Rat   222 YILITEFVGLGYRRMVGICYQIAF----------TVGLLILAGVA-----YVIPNWRWLQFAVTL 271
            |..::|| .:...|.|.|.|...|          |..|::.:..|     :|...||.|.....|
  Fly   142 YAYLSEF-NIPRHRAVAINYSTMFVSVTAIYVPATAWLVLSSNWAITMGDFVFRPWRLLLLVSLL 205

  Rat   272 PNF---CFLLYFWCIPESPRWLISQNKIVKAMKIIKHIAKKN-GKSVPVSLQNLTPDEDAGKKLK 332
            |.|   ..|||:   ||||::|:||.|..:|::.:..|:|.| |||:.   |.|:.||...|...
  Fly   206 PGFIGGLILLYY---PESPKFLLSQEKNNEAIEAVAWISKFNRGKSIQ---QVLSCDEFTLKSED 264

  Rat   333 PSILDLVRTPQ-------IRKHTLILMYN-------------------------WF--------- 356
            |...:|:...|       |.:.|:.|.:.                         ||         
  Fly   265 PVGENLLGESQGCGILSKICRATIPLFHKPHGFNFILCNLALFGMFFSSNGMQLWFPEIVNRSSG 329

  Rat   357 ---TSSVLYQGLIMHMGLAGDNI--------------YLDFFYSALVEFPAAFII-----ILTID 399
               .||.:.:  |:.:.:...|:              |:|   :.:|.|  ||:|     .|.::
  Fly   330 AENNSSTVCE--ILSVPVEQPNVTETLDCTDPISSKTYID---NLVVGF--AFLIGFSIQGLILN 387

  Rat   400 RVGRRYPWAVSNMVAGA---ACLASVFI-----PDDLQWLKITIACLGRM--GITMAYEMVCLVN 454
            .:||:      |::..|   |.|:.|.:     |..:    :.:.||..:  |::::..:..:| 
  Fly   388 PLGRK------NVLLAALAVATLSGVLLHFMESPTGV----LVLFCLYILLPGLSISIMIGAIV- 441

  Rat   455 AELYPTYIRNLGVLVCSSMCDIGGIITPFLVYRLTDIWMEFPLVVFAVVGLVAGALVLLLP 515
             :|.||::|:..|..|.|:..:|.|....|:..:...:......:|....:|...:|..||
  Fly   442 -DLVPTHLRSKAVSFCMSLGRLGIIAATNLMGVMLQPYCNTTFAMFTCTLIVCIVIVHYLP 501

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Slc22a2NP_113772.1 2A0119 12..525 CDD:273328 105/451 (23%)
MFS 125..492 CDD:119392 100/426 (23%)
CG31103NP_001097914.1 2A0115 29..475 CDD:273327 100/423 (24%)
MFS 34..>189 CDD:119392 28/112 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166346939
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.