DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Slc22a2 and CG33233

DIOPT Version :9

Sequence 1:NP_113772.1 Gene:Slc22a2 / 29503 RGDID:61936 Length:593 Species:Rattus norvegicus
Sequence 2:NP_995978.2 Gene:CG33233 / 2769005 FlyBaseID:FBgn0053233 Length:489 Species:Drosophila melanogaster


Alignment Length:415 Identity:103/415 - (24%)
Similarity:173/415 - (41%) Gaps:97/415 - (23%)


- Green bases have known domain annotations that are detailed below.


  Rat   159 GFFIGAMMIGYLADRFGRKFCLLVTILINAIS-GALMAISPNYAWMLVFRFLQG--LVSKAGWLI 220
            |.....:.||:||||:||||.:.:. |:.|:| ..:.|:.|:...:.|.|.:.|  |.:.|...:
  Fly    68 GMVASGLFIGFLADRYGRKFVIRLA-LVGALSFSVISALMPDLYSLSVIRIIVGTFLSAVASLQV 131

  Rat   221 GYILITEFVGLGYRRM-VGICYQIAFTVGLLI----LAGVAYVIPN--------------WRWLQ 266
            |:  :.||..:.:|.: |.||.|   :.||.:    |..:| ::||              ||:|.
  Fly   132 GF--LGEFHAIKWRPITVAICSQ---SQGLALIYCPLVAMA-ILPNNFNVDLSSSYNLRVWRFLM 190

  Rat   267 FAVTLPNFCFLLYFWCIPESPRWLISQNKIVKAMKIIKHIAKKNGK---SVPVSL---QNLTPDE 325
            ....:|.:..|:....:||:|.:|:|.|:..||:..:|.|.:.|.|   .|.::|   ::.|.|:
  Fly   191 MFFMIPGWLALVGICLVPETPHFLMSVNRPDKALLALKWICRMNRKKWEDVDITLSEEKSSTNDQ 255

  Rat   326 DA-GKKLKPSILDLVRTPQIRKH--TLILMYNWFTSSV---LYQGLIMHMGLAGDNIYLDFFYSA 384
            :. .|.:......|...|.:.|.  .|.|::..|.:|:   ::..:|.:|..:|.|...|     
  Fly   256 EGFWKTVWYEYKLLFSKPHVFKFFICLFLIFGIFFTSIGLGIWFPVIRNMDNSGSNRLCD----- 315

  Rat   385 LVEFPAAFIIILTIDRVGR-----RYPWAVSNMV---------AGAACLASVFIPDDLQWL--KI 433
            ||.....||.....|..|.     :....::|::         .|...||||.:    .|:  |.
  Fly   316 LVNNNPTFINHEADDTNGTDSESPKCNDEMTNLIDPVYYGFTYIGCFILASVLV----HWMTRKY 376

  Rat   434 TIACLGRMGITMAYEMVCLVNAELYPTYIRNLGVLVCSSMCDIGGIITPFLVYRLTDIWMEFPLV 498
            .||    :.|.::..:...:|....||.:....||    |..:.|::.|                
  Fly   377 VIA----LHILISMILGISLNIMKQPTVVLIFFVL----MMVLPGVLIP---------------- 417

  Rat   499 VFAVVGLVAGALVLLLP-ETKGKAL 522
                  |....||..|| ..:||||
  Fly   418 ------LATSVLVDCLPVNLRGKAL 436

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Slc22a2NP_113772.1 2A0119 12..525 CDD:273328 103/415 (25%)
MFS 125..492 CDD:119392 94/382 (25%)
CG33233NP_995978.2 MFS_1 22..451 CDD:284993 103/415 (25%)
MFS 23..>208 CDD:119392 40/146 (27%)
MFS 354..>482 CDD:304372 27/117 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166346936
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.