DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gstt2 and GstD8

DIOPT Version :9

Sequence 1:NP_036928.1 Gene:Gstt2 / 29487 RGDID:69362 Length:244 Species:Rattus norvegicus
Sequence 2:NP_524916.1 Gene:GstD8 / 48341 FlyBaseID:FBgn0010044 Length:212 Species:Drosophila melanogaster


Alignment Length:209 Identity:54/209 - (25%)
Similarity:95/209 - (45%) Gaps:35/209 - (16%)


- Green bases have known domain annotations that are detailed below.


  Rat     3 LELYLDLLSQPSRAVYIFAKKNGIPFQLRTVDLLKGQHLSEQFSQVNCLKKVPVLKDGSFVLTES 67
            ::.|....|.|.|:|.:.||..|:...::.:.::.|:.|..:|.::|....:|.|.|..|.:.||
  Fly     1 MDFYYHPCSAPCRSVIMTAKALGVDLNMKLLKVMDGEQLKPEFVKLNPQHCIPTLVDDGFSIWES 65

  Rat    68 TAILIYLSSKYQVADHWYPADLQARAQVHEYLGWHADNIRGTFGVLLWTKVLGPLIGVQVPEEKV 132
            .||||||..||...|..||:|.|.:|.|::.|.:....:..:|              |:....::
  Fly    66 RAILIYLVEKYGADDSLYPSDPQKKAVVNQRLYFDMGTLFQSF--------------VEAIYPQI 116

  Rat   133 ERNRNSMVLALQRLE------DKFLRDRAFIAGQQVTLADLMSLEELIQPVALGCNLFE------ 185
            ..|..:...|:|:::      |.||.|:.::||..:|:||:..|..:        :.||      
  Fly   117 RNNHPADPEAMQKVDSAFGHLDTFLEDQEYVAGDCLTIADIALLASV--------STFEVVDFDI 173

  Rat   186 -GRPQLTAWRERVE 198
             ..|.:..|.|..:
  Fly   174 AQYPNVARWYENAK 187

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
Gstt2NP_036928.1 GST_N_Theta 3..78 CDD:239348 24/74 (32%)