DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gstt2 and GstD5

DIOPT Version :9

Sequence 1:NP_036928.1 Gene:Gstt2 / 29487 RGDID:69362 Length:244 Species:Rattus norvegicus
Sequence 2:NP_524914.3 Gene:GstD5 / 48338 FlyBaseID:FBgn0010041 Length:216 Species:Drosophila melanogaster


Alignment Length:173 Identity:43/173 - (24%)
Similarity:77/173 - (44%) Gaps:18/173 - (10%)


- Green bases have known domain annotations that are detailed below.


  Rat     3 LELYLDLLSQPSRAVYIFAKKNGIPFQLRTVDLLKGQHLSEQFSQVNCLKKVPVLKDGSFVLTES 67
            ::.|........|.|.:.||..|:...::.::.|:...|..:|.::|....:|.|.|..|.:.||
  Fly     1 MDFYYSPRGSGCRTVIMVAKALGVKLNMKLLNTLEKDQLKPEFVKLNPQHTIPTLVDNGFSIWES 65

  Rat    68 TAILIYLSSKYQVADHWYPADLQARAQVHEYLGWHADNIRGTFGVLLWTKVLGPLIGVQVPE--- 129
            .||.:||..||...|..:|.|.:.:|.|::.|.:....:..:|     .|...||.....|.   
  Fly    66 RAIAVYLVEKYGKDDTLFPKDPKKQALVNQRLYFDMGTLYDSF-----AKYYYPLFHTGKPGSDE 125

  Rat   130 --EKVERNRNSMVLALQRLEDKFLRDRAFIAGQQVTLADLMSL 170
              :|:|.:...:.:        ||..:.::||..:|:||:..|
  Fly   126 DFKKIESSFEYLNI--------FLEGQNYVAGDHLTVADIAIL 160

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
Gstt2NP_036928.1 GST_N_Theta 3..78 CDD:239348 20/74 (27%)