DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gstt2 and GstD11

DIOPT Version :9

Sequence 1:NP_036928.1 Gene:Gstt2 / 29487 RGDID:69362 Length:244 Species:Rattus norvegicus
Sequence 2:NP_001138040.1 Gene:GstD11 / 41512 FlyBaseID:FBgn0038029 Length:243 Species:Drosophila melanogaster


Alignment Length:188 Identity:62/188 - (32%)
Similarity:90/188 - (47%) Gaps:13/188 - (6%)


- Green bases have known domain annotations that are detailed below.


  Rat    11 SQPSRAVYIFAKKNGIPFQLRTVDLLKGQHLSEQFSQVNCLKKVPVLKDGSFVLTESTAILIYLS 75
            |.|.|::.:.||...|.|:|:.|::|:|:.|...|..:|....||.:.|...||.||.|||.||.
  Fly    33 SPPCRSILLLAKMLDIDFELKIVNILEGEQLKPDFVAMNPQHCVPTMNDEGLVLWESRAILSYLV 97

  Rat    76 SKYQVADHWYPADLQARAQVHEYLGWHADNIRGTFGVLLWTKVLGPLIGVQVPEEKVERNRNSMV 140
            :.|..:|..||.|::.||.|.:.|.:..    ||..:.| |....|.:.:..|.:  |..|..:.
  Fly    98 A
AYGKSDQLYPTDIRVRALVDQRLQFDL----GTLYMRL-TDYYFPTMFIGAPLD--EGKRAKLA 155

  Rat   141 LALQRLEDKFLRDRAFIAGQQVTLADLMSLEELIQPVALGCNLFEGRP--QLTAWRER 196
            .|:..| :..|..|.|.|....|:|||..|..:.|..|..   ||.||  .:..|.:|
  Fly   156 EAVGWL-NTILEGRQFSAADHFTIADLTLLVTVSQLEAFE---FELRPYKHIRQWLDR 209

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
Gstt2NP_036928.1 GST_N_Theta 3..78 CDD:239348 26/66 (39%)