DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gstt2 and GstE7

DIOPT Version :9

Sequence 1:NP_036928.1 Gene:Gstt2 / 29487 RGDID:69362 Length:244 Species:Rattus norvegicus
Sequence 2:NP_611329.1 Gene:GstE7 / 37112 FlyBaseID:FBgn0063493 Length:223 Species:Drosophila melanogaster


Alignment Length:209 Identity:58/209 - (27%)
Similarity:96/209 - (45%) Gaps:35/209 - (16%)


- Green bases have known domain annotations that are detailed below.


  Rat     2 GLELYLDLLSQPSRAVYIFAKKNGIPFQLRTVDLLKGQHLSEQFSQVNCLKKVPVLKDGSFVLTE 66
            |||     .|.|.|||.:......:|::...|:....::.||:|.:.|....||.|:|....:.:
  Fly     8 GLE-----ASPPVRAVKLTLAALEVPYEFVEVNTRAKENFSEEFLKKNPQHTVPTLEDDGHYIWD 67

  Rat    67 STAILIYLSSKYQVADHWYPADLQARAQVHEYLGWHADNIRGTFGVLL---WTKVLGPLIG---V 125
            |.||:.||.|||...|..||.||..||.|.:.|.:.:       ||:.   ...:..||..   .
  Fly    68 SHAIIAYLVSKYGKTDSLYPKDLLQRAVVDQRLHFES-------GVIFANALRSITKPLFAGKQT 125

  Rat   126 QVPEEKVERNRNSMVLALQRLEDKFLRDRAFIAGQQVTLAD------LMSLEELIQPVALGCNLF 184
            .:|:|     |...::.:....:|||....::||.|:|:||      :.|||..::   :....:
  Fly   126 MIPKE-----RYDAIIEVYDFLEKFLAGNDYVAGNQLTIADFSIISTVSSLEVFVK---VDTTKY 182

  Rat   185 EGRPQLTAWRERVE 198
               |::.||.:|::
  Fly   183 ---PRIAAWFKRLQ 193

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
Gstt2NP_036928.1 GST_N_Theta 3..78 CDD:239348 23/74 (31%)