DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gstt2 and GstE3

DIOPT Version :9

Sequence 1:NP_036928.1 Gene:Gstt2 / 29487 RGDID:69362 Length:244 Species:Rattus norvegicus
Sequence 2:NP_611325.2 Gene:GstE3 / 37108 FlyBaseID:FBgn0063497 Length:220 Species:Drosophila melanogaster


Alignment Length:200 Identity:56/200 - (28%)
Similarity:94/200 - (47%) Gaps:31/200 - (15%)


- Green bases have known domain annotations that are detailed below.


  Rat    11 SQPSRAVYIFAKKNGIPFQLRTVDLLKGQHLSEQFSQVNCLKKVPVLKDGSFVLTESTAILIYLS 75
            |.|.|:|.:..:...:.|..:.|:|::.:||..:|.::|.|..||.|.|..|.|.:|.||..||.
  Fly    12 SPPVRSVLLTLRALNLDFDYKIVNLMEKEHLKPEFLKINPLHTVPALDDNGFYLADSHAINSYLV 76

  Rat    76 SKYQVADHWYPADLQARAQVHEYLGWHADNIRGTFGV----LLWTKVLGPLIGVQVPEEKVERNR 136
            |||...|..||.||:.||.|.:.|.:.:..:..|...    |.|..      ..::|:.:::   
  Fly    77 SKYGRNDSLYPKDLKKRAIVDQRLHYDSSVVTSTGRAITFPLFWEN------KTEIPQARID--- 132

  Rat   137 NSMVLALQ---RLEDKFLRDRAFIAGQQVTLADLMSLEELIQPVALGCNLF-----EGRPQLTAW 193
                 ||:   :..:.||.:..::||..:|:||...:..|     .|..:|     ...|:|.||
  Fly   133 -----ALEGVYKSLNLFLENGNYLAGDNLTIADFHVIAGL-----TGFFVFLPVDATKYPELAAW 187

  Rat   194 RERVE 198
            .:|::
  Fly   188 IKRIK 192

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
Gstt2NP_036928.1 GST_N_Theta 3..78 CDD:239348 24/66 (36%)