DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gstt2 and GstE9

DIOPT Version :9

Sequence 1:NP_036928.1 Gene:Gstt2 / 29487 RGDID:69362 Length:244 Species:Rattus norvegicus
Sequence 2:NP_725784.1 Gene:GstE9 / 246581 FlyBaseID:FBgn0063491 Length:221 Species:Drosophila melanogaster


Alignment Length:206 Identity:61/206 - (29%)
Similarity:98/206 - (47%) Gaps:19/206 - (9%)


- Green bases have known domain annotations that are detailed below.


  Rat     1 MG-LELYLDLLSQPSRAVYIFAKKNGIPFQLRTVDLLKGQHLSEQFSQVNCLKKVPVLKDGSFVL 64
            || |.||....|.|.||..:.....|:.::.|.|:||.|:|.:::||..|....||||:|....:
  Fly     1 MGKLVLYGVEASPPVRACKLTLDALGLQYEYRLVNLLAGEHKTKEFSLKNPQHTVPVLEDDGKFI 65

  Rat    65 TESTAILIYLSSKYQVADHWYPADLQARAQVHEYLGWHADNIRGTFGVLLW---TKVLGPLIGVQ 126
            .||.||..||..:|..:|..||.|...||.|.:.|.:.:       |||..   ..:..||....
  Fly    66 WESHAICAYLVRRYAKSDDLYPKDYFKRALVDQRLHFES-------GVLFQGCIRNIAIPLFYKN 123

  Rat   127 VPEEKVERNRNSMVLALQRLEDKFLRDRAFIAGQQVTLAD---LMSLEELIQPVALGCNLFEGRP 188
            :.|  |.|::...:.......:.|:.::|::.|..:|:||   :.|:..|:...|:....:   |
  Fly   124 ITE--VPRSQIDAIYEAYDFLEAFIGNQAYLCGPVITIADYSVVSSVSSLVGLAAIDAKRY---P 183

  Rat   189 QLTAWRERVEA 199
            :|..|.:|:.|
  Fly   184 KLNGWLDRMAA 194

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
Gstt2NP_036928.1 GST_N_Theta 3..78 CDD:239348 28/74 (38%)