DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pdia3 and CaBP1

DIOPT Version :9

Sequence 1:NP_059015.2 Gene:Pdia3 / 29468 RGDID:68430 Length:510 Species:Rattus norvegicus
Sequence 2:NP_001285979.1 Gene:CaBP1 / 34976 FlyBaseID:FBgn0025678 Length:433 Species:Drosophila melanogaster


Alignment Length:500 Identity:111/500 - (22%)
Similarity:162/500 - (32%) Gaps:241/500 - (48%)


- Green bases have known domain annotations that are detailed below.


  Rat    16 LASALL-------ASALLASASDVLELTDENFESRVSDTGSAGLMLVEFFAPWCGHCKRLAPEYE 73
            |||.||       .||..:.:..|:|||..||:..|....:  :.:|||:|||||||:.|.|||:
  Fly     4 LASILLLAFVVGSVSAFYSPSDGVVELTPSNFDREVLKDDA--IWVVEFYAPWCGHCQSLVPEYK 66

  Rat    74 AAATRLKGIVPLAKVDCTANTNTCNKYGVSGYPTLKIFRDGEEAGA-YDGPRTADGIVSHLKKQA 137
            ..|..|||:|.:..|:..|::....::||.|:||:|||...:::.. |:|.|||..|.     :|
  Fly    67 KLAKALKGVVKVGSVNADADSTLSGQFGVRGFPTIKIFGANKKSPTDYNGQRTAKAIA-----EA 126

  Rat   138 GPASVPLRTEDEFKKFISDKDASVVGFFRDLFSDGHSEFLKAASNLRDNYRFAHTNVESLVKEYD 202
            ..|        |.||    |...|:|      ..|.|                           .
  Fly   127 ALA--------EVKK----KVQGVLG------GGGGS---------------------------S 146

  Rat   203 DNGEGITIFRPLHLANKFEDKIVAYTEKKMTSGKIKKFIQESIFGLCPHMTEDNKDLIQGKDLLT 267
            ..|.|         ::..:|.|                          .:||||           
  Fly   147 SGGSG---------SSSGDDVI--------------------------ELTEDN----------- 165

  Rat   268 AYYDVDYEKNTKGSNYWRNRVMMVAKTFLDAGHKLNFAVASRKTFSHELSDFGLESTTGEIPVVA 332
                                                                             
  Fly   166 ----------------------------------------------------------------- 165

  Rat   333 IRTAKGEKFVMQEEFSRDGKALERFLQEYFDGNLKRYLKSEPIPETNEGPVKVVVAESFDDIVNA 397
                                                                      ||.:|..
  Fly   166 ----------------------------------------------------------FDKLVLN 172

  Rat   398 EDKDVLIEFYAPWCGHCKNLEPKYKELGEKLSKDPNIVIAKMDATAN-DVPSPYEVKGFPTIYFS 461
            .|...|:||:||||||||||.|::.:..::|.  ..:.:..:||||: ...:.|.|:|:|||.|.
  Fly   173 SDDIWLVEFFAPWCGHCKNLAPEWAKAAKELK--GKVKLGALDATAHQSKAAEYNVRGYPTIKFF 235

  Rat   462 PANKKLT--PKKYEGGRELNDFISYL-QREATNPP------IIQE 497
            ||..|..  .::|:|||..:|.:|:. .:...|.|      ||.|
  Fly   236 PAGSKRASDAQEYDGGRTASDIVSWASDKHVANVPAPELIEIINE 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pdia3NP_059015.2 ER_PDI_fam 31..492 CDD:273457 99/465 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 489..510 4/14 (29%)
Prevents secretion from ER 507..510
CaBP1NP_001285979.1 PDI_a_P5 26..119 CDD:239299 38/94 (40%)
PDI_a_P5 157..262 CDD:239299 45/266 (17%)
Thioredoxin_6 190..383 CDD:290560 29/92 (32%)
P5_C 271..400 CDD:239281 2/9 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.