DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Neurod1 and tap

DIOPT Version :9

Sequence 1:NP_062091.1 Gene:Neurod1 / 29458 RGDID:3165 Length:357 Species:Rattus norvegicus
Sequence 2:NP_524124.1 Gene:tap / 39935 FlyBaseID:FBgn0015550 Length:398 Species:Drosophila melanogaster


Alignment Length:325 Identity:91/325 - (28%)
Similarity:125/325 - (38%) Gaps:75/325 - (23%)


- Green bases have known domain annotations that are detailed below.


  Rat    14 PQPQGPPSWTDECLSS----------QDEEHEADKKEDELEAMNAEEDSLRNGGEEEDEDEDLEE 68
            |||....:|....|||          ....|........:|.:|:.   ..||    ..|..|..
  Fly    57 PQPYSGGTWDAVPLSSPPAGFVGLLDTSSNHSTRSGRTLVEHLNSR---ATNG----VFDPPLTS 114

  Rat    69 EE-EEEEEEDDQKPKRR-GPKKKKMTKAR-------LERFKLRRMKANARERNRMHGLNAALDNL 124
            .. :..|:.:..:|||: ...|.::|::|       ::||  ||||||.|||||||.||.||:.|
  Fly   115 TPVKSPEDPNAPRPKRKYAVGKNRVTRSRSPTQVVKIKRF--RRMKANDRERNRMHNLNDALEKL 177

  Rat   125 RKVVPCYSKTQKLSKIETLRLAKNYIWALSEILRSGKS--PDLVSFVQTLCKGLSQPTTNLVAGC 187
            |..:|...:..||:|||.||.|.|||:||.::|.||.|  .||.........|  :..|..:...
  Fly   178 RVTLPSLPEETKLTKIEILRFAHNYIFALEQVLESGGSINLDLEKLQNFTLSG--ERITKELFDA 240

  Rat   188 LQLNPRTFLPEQNPDMPPHLPTASASFPVHPYSYQSPGLPSPPYGTMDSSHVFHVKPPPHAYSAA 252
            |.:||:.:            |.....||     |.....|...:.|..:|   |.:.||     |
  Fly   241 LFVNPQPY------------PLFGRMFP-----YGQGMAPLAQHQTAPAS---HAEQPP-----A 280

  Rat   253 LEPFFESPLTDCTSPSFDGPLSPP-LSINGNFSFKHEPSTEFEKNYAFTMHYPAATLAGPQSHGS 316
            :..|         ....|.|..|| ....|:..|.|:...:        .|.|......||...|
  Fly   281 MGGF---------QHGMDYPQQPPGFDFTGSMRFYHQQQQQ--------PHQPHHLQPNPQQESS 328

  Rat   317  316
              Fly   329  328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Neurod1NP_062091.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..94 20/91 (22%)
bHLH_TS_NeuroD1 75..160 CDD:381562 42/92 (46%)
Nuclear localization signal. /evidence=ECO:0000255 87..93 1/5 (20%)
Neuro_bHLH 160..284 CDD:403655 26/126 (21%)
tapNP_524124.1 HLH 155..207 CDD:278439 32/51 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166339122
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3898
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.