DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ahcy and AhcyL2

DIOPT Version :9

Sequence 1:NP_058897.1 Gene:Ahcy / 29443 RGDID:69260 Length:432 Species:Rattus norvegicus
Sequence 2:NP_996221.1 Gene:AhcyL2 / 42043 FlyBaseID:FBgn0015011 Length:504 Species:Drosophila melanogaster


Alignment Length:423 Identity:214/423 - (50%)
Similarity:297/423 - (70%) Gaps:1/423 - (0%)


- Green bases have known domain annotations that are detailed below.


  Rat     9 VADIGLAAWGRKALDIAENEMPGLMRMREMYSASKPLKGARIAGCLHMTVETAVLIETLVALGAE 73
            |..|..:|:||:.::|||:||||:|.:|:.....||||||.|.||.|:..::||||||||.|||.
  Fly    70 VKSISKSAFGRREIEIAESEMPGIMTLRKRAKDEKPLKGANIVGCTHVNAQSAVLIETLVQLGAT 134

  Rat    74 VRWSSCNIFSTQDHAAAAIAKAGIPVFAWKGETDEEYLWCIEQTLHFKDGPLNMILDDGGDLTNL 138
            |||::|||:|||:..|||:|:||||:|||:|||:||:.||:::.::......|:|||||||.|:|
  Fly   135 VRWAACNIYSTQNAVAAALAEAGIPIFAWRGETEEEFWWCLDRAIYSDGWQPNLILDDGGDATHL 199

  Rat   139 IHTKHPQLLSGIRGISEETTTGVHNLYKMMANGILKVPAINVNDSVTKSKFDNLYGCRESLIDGI 203
            :..|:|.....||||.||:.||||.||.:...|.|.||||||||||||:|||..|.||:|::|.:
  Fly   200 MLKKYPDYFKAIRGIVEESVTGVHRLYMLSKGGKLTVPAINVNDSVTKNKFDTFYTCRDSILDSL 264

  Rat   204 KRATDVMIAGKVAVVAGYGDVGKGCAQALRGFGARVIITEIDPINALQAAMEGYEVTTMDEACKE 268
            ||.||:|..||..|:.|||||||||||:|:|.|..|.:||:|||.||||||:|:.|..::|..:.
  Fly   265 KRTTDIMFGGKQVVICGYGDVGKGCAQSLKGQGCIVYVTEVDPICALQAAMDGFRVVRLNEVIRT 329

  Rat   269 GNIFVTTTGCVDIILGRHFEQMKDDAIVCNIGHFDVEIDVKWLNENAVEKVNIKPQVDRYLLKNG 333
            .::.||.||..::|...|..:||:..|:||:||...||||..|:...:....::.|||.....:|
  Fly   330 VDVVVTATGNKNVITRDHMNRMKNGCILCNMGHSCSEIDVNGLHTPELTWERVRSQVDHIRWPDG 394

  Rat   334 HRIILLAEGRLVNLGCAMGHPSFVMSNSFTNQVMAQIELWTHPDKYPVGVHFLPKKLDEAVAEAH 398
            ..||||||||||||.|:. ..|||:|.:.:.|.:|.|||::.|.:|...|:.||||:||.||..|
  Fly   395 RMIILLAEGRLVNLSCST-ISSFVVSVASSTQALALIELFSAPGRYKSDVYLLPKKMDEYVASLH 458

  Rat   399 LGKLNVKLTKLTEKQAQYLGMPINGPFKPDHYR 431
            |...:..||:||::|::::|:...||||.::||
  Fly   459 LATFDAHLTELTDEQSKFMGLNKAGPFKANYYR 491

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AhcyNP_058897.1 PRK05476 1..426 CDD:235488 210/416 (50%)
AdoHcyase 6..431 CDD:283003 212/421 (50%)
AhcyL2NP_996221.1 PRK05476 63..486 CDD:235488 210/416 (50%)
AdoHcyase 67..491 CDD:283003 212/421 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0499
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D371693at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.