DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ahcy and AhcyL1

DIOPT Version :9

Sequence 1:NP_058897.1 Gene:Ahcy / 29443 RGDID:69260 Length:432 Species:Rattus norvegicus
Sequence 2:NP_647746.1 Gene:AhcyL1 / 38342 FlyBaseID:FBgn0035371 Length:521 Species:Drosophila melanogaster


Alignment Length:426 Identity:220/426 - (51%)
Similarity:306/426 - (71%) Gaps:3/426 - (0%)


- Green bases have known domain annotations that are detailed below.


  Rat     9 VADIGLA-AWGRKALDIAENEMPGLMRMREMYSASKPLKGARIAGCLHMTVETAVLIETLVALGA 72
            |.:||.. |:||:.::|||.||||::.:::..:..||||.|:|.||.|:..:|||||||||.|||
  Fly    97 VRNIGAQHAFGRREIEIAEQEMPGIIALKKRAAEDKPLKDAKIVGCTHINAQTAVLIETLVELGA 161

  Rat    73 EVRWSSCNIFSTQDHAAAAIAKAGIPVFAWKGETDEEYLWCIEQTLHFKDGPLNMILDDGGDLTN 137
            .|||::|||:|||:..|||:|::|||:|||:|||:|::.|||::.::.::...|||||||||.|:
  Fly   162 SVRWAACNIYSTQNEVAAALAESGIPIFAWRGETEEDFWWCIDRCVNAENWQPNMILDDGGDATH 226

  Rat   138 LIHTKHPQLLSGIRGISEETTTGVHNLYKMMANGILKVPAINVNDSVTKSKFDNLYGCRESLIDG 202
            |:..|:|.:...::||.||:.||||.||::...|.|.|||:||||||||:||||||.|:||::|.
  Fly   227 LMLKKYPTMFKLVKGIVEESVTGVHRLYQLSKAGKLTVPAMNVNDSVTKTKFDNLYSCKESILDS 291

  Rat   203 IKRATDVMIAGKVAVVAGYGDVGKGCAQALRGFGARVIITEIDPINALQAAMEGYEVTTMDEACK 267
            :||:||||..||..||.|||||||||||||:|.|..|.|||||||.||||:|:|:.|..::|..:
  Fly   292 LKRSTDVMFGGKQVVVCGYGDVGKGCAQALKGQGCIVYITEIDPICALQASMDGFRVVKLNEVIR 356

  Rat   268 EGNIFVTTTGCVDIILGRHFEQMKDDAIVCNIGHFDVEIDVKWLNENAVEKVNIKPQVDRYLLKN 332
            ..:|.||.||..::::..|.::||...||||:||.:.||||..|....:....::.|||..:...
  Fly   357 NVDIVVTATGNKNVVVREHMDKMKSGCIVCNMGHSNTEIDVNGLRTPDLTWEKVRSQVDHIIWPE 421

  Rat   333 GHRIILLAEGRLVNLGCAMGHPSFVMSNSFTNQVMAQIELW-THPDKYPVGVHFLPKKLDEAVAE 396
            |..||||||||||||.|: ..|||.:|.:...|.:|.|||: ..|.:|...|:.||||:||.||.
  Fly   422 GKYIILLAEGRLVNLSCS-SIPSFAVSITSATQALALIELFNAPPGRYKSDVYLLPKKMDEYVAS 485

  Rat   397 AHLGKLNVKLTKLTEKQAQYLGMPINGPFKPDHYRY 432
            .||...:..||:|:::||:|:|:...|||||::|||
  Fly   486 LHLPTFDAHLTELSDEQAKYMGLNKAGPFKPNYYRY 521

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AhcyNP_058897.1 PRK05476 1..426 CDD:235488 214/418 (51%)
AdoHcyase 6..431 CDD:283003 217/423 (51%)
AhcyL1NP_647746.1 AdoHcyase 94..520 CDD:336064 217/423 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0499
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D371693at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.