DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lrrtm3 and Fili

DIOPT Version :9

Sequence 1:NP_001099857.1 Gene:Lrrtm3 / 294380 RGDID:1304866 Length:582 Species:Rattus norvegicus
Sequence 2:NP_001369108.1 Gene:Fili / 5740472 FlyBaseID:FBgn0085397 Length:789 Species:Drosophila melanogaster


Alignment Length:403 Identity:93/403 - (23%)
Similarity:162/403 - (40%) Gaps:96/403 - (23%)


- Green bases have known domain annotations that are detailed below.


  Rat    20 PTVLLTMLS------SAERGCPKGCRCEG----KMVYCESQKLQEIPSSISAGCLGLSLRYNSLQ 74
            |.:||.:|:      .....||..|:|.|    ....|....|:::|..::.....::|..|.::
  Fly    22 PVLLLLLLTLVILPPETTAFCPSKCQCLGGEANSRALCVDAALEDVPIQLNPETKYINLTVNRIR 86

  Rat    75 KLKYN-----------------------QFKGLNQLTWLYLDHNHISNIDENAFNGIRRLKELIL 116
            .|:::                       .|:..::|..|.|..|.:|::.::||.|:..|..|.|
  Fly    87 TLEFSLPFYMKLEILDLSQNIIETLGSKNFEYQSELRTLNLSRNLVSSLHKHAFKGLTNLLLLDL 151

  Rat   117 SSNRISYFLNNTFRPVTNLRNLDLSYNQLHSLGSEQFRGLRKLLSLHLRSNSLRTIPVRIFQDCR 181
            |.|||..........:.:|..|||:.|.:.||....|:|:..|..|..|:|.|..:|........
  Fly   152 SFNRIETVHPTALSDLASLVELDLTNNNIVSLEDNCFKGMNTLEVLVFRNNRLLDVPASNLWHLH 216

  Rat   182 NLELLDLGYNRIRSLARNVFAGMIRLKELHLEHNQFSKLNLALFPRLVSLQNLYMQWNKISVIGQ 246
            .|:.||:..|.:..:..:.|.|:..|..|.::.|..|:|:|:.|..|:||::|.:..|.::::..
  Fly   217 ALKSLDMSLNLVEFVRNDSFEGLKELLALSVQGNVMSELDLSAFEGLISLKHLDLSDNNLTMVPT 281

  Rat   247 TMSWTWSSLQRLDLSGN------------------------------EIEAF------------S 269
            ......|:|..|:|.||                              :..||            :
  Fly   282 QQLSKLSNLTYLNLGGNRFSQLPAVAFLNLFHLRELHLSRLDFLQRIDSRAFVDNTHLQTLHLNN 346

  Rat   270 GPS-------VFQCVPNLQRLNLDSNKL--TFIGQEILDSWISLNDISLAGNIWECSRNICSLVN 325
            .|.       :||..||:..:.:.||.|  .:..|..:|   .|..:.|..|..:|:   |||: 
  Fly   347 NPQLSDIPMRLFQGNPNILEVYMQSNSLQTLYSAQFPVD---QLQKLYLGDNPLQCN---CSLL- 404

  Rat   326 WL-----KSFKGL 333
            ||     .:|:|:
  Fly   405 WLWRLVTGNFEGV 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lrrtm3NP_001099857.1 LRRNT 33..61 CDD:214470 8/31 (26%)
LRR 1 61..83 4/44 (9%)
leucine-rich repeat 66..86 CDD:275380 4/42 (10%)
LRR_RI <81..300 CDD:238064 66/269 (25%)
LRR 2 84..107 7/22 (32%)
LRR_8 86..145 CDD:290566 20/58 (34%)
leucine-rich repeat 87..110 CDD:275380 8/22 (36%)
LRR 3 109..131 7/21 (33%)
leucine-rich repeat 111..134 CDD:275380 7/22 (32%)
LRR 4 132..155 8/22 (36%)
LRR_8 133..193 CDD:290566 19/59 (32%)
leucine-rich repeat 135..158 CDD:275380 9/22 (41%)
LRR 5 156..179 6/22 (27%)
leucine-rich repeat 159..182 CDD:275380 6/22 (27%)
LRR_8 181..241 CDD:290566 18/59 (31%)
LRR 6 181..203 5/21 (24%)
leucine-rich repeat 183..206 CDD:275380 6/22 (27%)
LRR 7 205..227 7/21 (33%)
leucine-rich repeat 207..230 CDD:275380 8/22 (36%)
LRR 8 229..251 4/21 (19%)
LRR_8 230..290 CDD:290566 19/108 (18%)
leucine-rich repeat 231..254 CDD:275380 3/22 (14%)
LRR 9 252..276 10/72 (14%)
leucine-rich repeat 255..279 CDD:275380 10/72 (14%)
LRR 10 277..300 6/24 (25%)
leucine-rich repeat 280..300 CDD:275380 4/21 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 378..411
FiliNP_001369108.1 leucine-rich repeat 75..97 CDD:275378 3/21 (14%)
leucine-rich repeat 98..121 CDD:275380 1/22 (5%)
LRR_8 120..180 CDD:404697 20/59 (34%)
leucine-rich repeat 122..145 CDD:275380 8/22 (36%)
leucine-rich repeat 146..169 CDD:275380 7/22 (32%)
LRR <161..>354 CDD:227223 42/192 (22%)
leucine-rich repeat 170..193 CDD:275380 9/22 (41%)
leucine-rich repeat 194..217 CDD:275380 6/22 (27%)
leucine-rich repeat 218..265 CDD:275380 14/46 (30%)
leucine-rich repeat 266..289 CDD:275380 3/22 (14%)
leucine-rich repeat 290..313 CDD:275380 5/22 (23%)
leucine-rich repeat 314..338 CDD:275380 2/23 (9%)
LRR_8 337..397 CDD:404697 13/62 (21%)
leucine-rich repeat 339..360 CDD:275380 2/20 (10%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24373
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.