Sequence 1: | NP_001099857.1 | Gene: | Lrrtm3 / 294380 | RGDID: | 1304866 | Length: | 582 | Species: | Rattus norvegicus |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001369108.1 | Gene: | Fili / 5740472 | FlyBaseID: | FBgn0085397 | Length: | 789 | Species: | Drosophila melanogaster |
Alignment Length: | 403 | Identity: | 93/403 - (23%) |
---|---|---|---|
Similarity: | 162/403 - (40%) | Gaps: | 96/403 - (23%) |
- Green bases have known domain annotations that are detailed below.
Rat 20 PTVLLTMLS------SAERGCPKGCRCEG----KMVYCESQKLQEIPSSISAGCLGLSLRYNSLQ 74
Rat 75 KLKYN-----------------------QFKGLNQLTWLYLDHNHISNIDENAFNGIRRLKELIL 116
Rat 117 SSNRISYFLNNTFRPVTNLRNLDLSYNQLHSLGSEQFRGLRKLLSLHLRSNSLRTIPVRIFQDCR 181
Rat 182 NLELLDLGYNRIRSLARNVFAGMIRLKELHLEHNQFSKLNLALFPRLVSLQNLYMQWNKISVIGQ 246
Rat 247 TMSWTWSSLQRLDLSGN------------------------------EIEAF------------S 269
Rat 270 GPS-------VFQCVPNLQRLNLDSNKL--TFIGQEILDSWISLNDISLAGNIWECSRNICSLVN 325
Rat 326 WL-----KSFKGL 333 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Lrrtm3 | NP_001099857.1 | LRRNT | 33..61 | CDD:214470 | 8/31 (26%) |
LRR 1 | 61..83 | 4/44 (9%) | |||
leucine-rich repeat | 66..86 | CDD:275380 | 4/42 (10%) | ||
LRR_RI | <81..300 | CDD:238064 | 66/269 (25%) | ||
LRR 2 | 84..107 | 7/22 (32%) | |||
LRR_8 | 86..145 | CDD:290566 | 20/58 (34%) | ||
leucine-rich repeat | 87..110 | CDD:275380 | 8/22 (36%) | ||
LRR 3 | 109..131 | 7/21 (33%) | |||
leucine-rich repeat | 111..134 | CDD:275380 | 7/22 (32%) | ||
LRR 4 | 132..155 | 8/22 (36%) | |||
LRR_8 | 133..193 | CDD:290566 | 19/59 (32%) | ||
leucine-rich repeat | 135..158 | CDD:275380 | 9/22 (41%) | ||
LRR 5 | 156..179 | 6/22 (27%) | |||
leucine-rich repeat | 159..182 | CDD:275380 | 6/22 (27%) | ||
LRR_8 | 181..241 | CDD:290566 | 18/59 (31%) | ||
LRR 6 | 181..203 | 5/21 (24%) | |||
leucine-rich repeat | 183..206 | CDD:275380 | 6/22 (27%) | ||
LRR 7 | 205..227 | 7/21 (33%) | |||
leucine-rich repeat | 207..230 | CDD:275380 | 8/22 (36%) | ||
LRR 8 | 229..251 | 4/21 (19%) | |||
LRR_8 | 230..290 | CDD:290566 | 19/108 (18%) | ||
leucine-rich repeat | 231..254 | CDD:275380 | 3/22 (14%) | ||
LRR 9 | 252..276 | 10/72 (14%) | |||
leucine-rich repeat | 255..279 | CDD:275380 | 10/72 (14%) | ||
LRR 10 | 277..300 | 6/24 (25%) | |||
leucine-rich repeat | 280..300 | CDD:275380 | 4/21 (19%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 378..411 | ||||
Fili | NP_001369108.1 | leucine-rich repeat | 75..97 | CDD:275378 | 3/21 (14%) |
leucine-rich repeat | 98..121 | CDD:275380 | 1/22 (5%) | ||
LRR_8 | 120..180 | CDD:404697 | 20/59 (34%) | ||
leucine-rich repeat | 122..145 | CDD:275380 | 8/22 (36%) | ||
leucine-rich repeat | 146..169 | CDD:275380 | 7/22 (32%) | ||
LRR | <161..>354 | CDD:227223 | 42/192 (22%) | ||
leucine-rich repeat | 170..193 | CDD:275380 | 9/22 (41%) | ||
leucine-rich repeat | 194..217 | CDD:275380 | 6/22 (27%) | ||
leucine-rich repeat | 218..265 | CDD:275380 | 14/46 (30%) | ||
leucine-rich repeat | 266..289 | CDD:275380 | 3/22 (14%) | ||
leucine-rich repeat | 290..313 | CDD:275380 | 5/22 (23%) | ||
leucine-rich repeat | 314..338 | CDD:275380 | 2/23 (9%) | ||
LRR_8 | 337..397 | CDD:404697 | 13/62 (21%) | ||
leucine-rich repeat | 339..360 | CDD:275380 | 2/20 (10%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR24373 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 2.100 |