DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Akt3 and JIL-1

DIOPT Version :9

Sequence 1:XP_038946556.1 Gene:Akt3 / 29414 RGDID:62390 Length:504 Species:Rattus norvegicus
Sequence 2:NP_001261697.1 Gene:JIL-1 / 39241 FlyBaseID:FBgn0020412 Length:1207 Species:Drosophila melanogaster


Alignment Length:381 Identity:138/381 - (36%)
Similarity:204/381 - (53%) Gaps:53/381 - (13%)


- Green bases have known domain annotations that are detailed below.


  Rat   141 NCSPTSQIDNIGEEEMDASTT--------HHKRKTMNDFDYLKLLGKGTFGKVILVREKA---SG 194
            |.:|....:...:.:::|.|.        ..:..::|||..:::||.|.:|:|.|||:..   :|
  Fly   223 NSTPLDLDNEAHQRDLEAVTDLKYYVKLYSDEAVSLNDFKIIRVLGTGAYGRVFLVRKLTRHDAG 287

  Rat   195 KYYAMKILKKEVIIAKDEVA-HTLTESRVLKN-TRHPFLTSLKYSFQTKDRLCFVMEYVNGGELF 257
            |.||||:|.|..::.|.:.| ||.||..||:. .|:|||.||.|:||:..:|..|:::.||||||
  Fly   288 KLYAMKVLNKITVVQKRKTAEHTKTERVVLEAIQRNPFLVSLHYAFQSSSKLYLVLDFANGGELF 352

  Rat   258 FHLSRERVFSEDRTRFYGAEIVSALDYLHSGKIVYRDLKLENLMLDKDGHIKITDFGLCKEGITD 322
            .||.....|.|.|.|.|.||:|.||:.||...|:|||:||||::||.:|||.::||||.|  |..
  Fly   353 THLYHSENFEESRVRVYIAEVVLALEQLHQLGIIYRDIKLENILLDGEGHIVLSDFGLSK--ILT 415

  Rat   323 AAT---MKTFCGTPEYLAPEVLEDNDYGR--AVDWWGLGVVMYEMMCGRLPFYNQD----HEKLF 378
            |..   ..:||||.||:|||::.....|.  |||||.:||:.:|::.|..||...|    ..::.
  Fly   416 AENEYRAHSFCGTLEYMAPEIIRTGPPGHDSAVDWWSVGVLTFELLTGASPFATSDGQVQQSEIS 480

  Rat   379 ELILMEDIKFPRTLSSDAKSLLSGLLIKDPNKRLGGGPDDAKEIMRHSFFSGVNWQDVYDKKMTT 443
            ..|..|....|.:.|::|:..:..:|.|:|.:||||...||.||..|.||:|:|||::..|:   
  Fly   481 RRIQKEQPMIPSSFSANARDFVLKMLEKNPKRRLGGNHRDASEIKEHPFFNGINWQELRTKR--- 542

  Rat   444 TAWTAWIMSGGHTSLSSPTLQAD------GNKFLSVCLYTVILDFATENDSWTSPP 493
                       ..:...|||.|:      .|:|         .|...|:....:||
  Fly   543 -----------RKAPYKPTLTAEDDVQNFSNEF---------TDQVPEDPECDAPP 578

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Akt3XP_038946556.1 PH_PKB 4..133 CDD:269947
PKc_like 175..442 CDD:419665 121/280 (43%)
JIL-1NP_001261697.1 S_TKc 261..530 CDD:214567 115/270 (43%)
STKc_MSK_N 266..533 CDD:270735 116/268 (43%)
S_TK_X 532..591 CDD:214529 15/70 (21%)
S_TKc 632..886 CDD:214567
PKc_like 632..885 CDD:304357
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.