DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Akt3 and S6k

DIOPT Version :9

Sequence 1:XP_038946556.1 Gene:Akt3 / 29414 RGDID:62390 Length:504 Species:Rattus norvegicus
Sequence 2:NP_001261450.1 Gene:S6k / 38654 FlyBaseID:FBgn0283472 Length:490 Species:Drosophila melanogaster


Alignment Length:276 Identity:129/276 - (46%)
Similarity:184/276 - (66%) Gaps:4/276 - (1%)


- Green bases have known domain annotations that are detailed below.


  Rat   170 DFDYLKLLGKGTFGKVILVREKA---SGKYYAMKILKKEVIIA-KDEVAHTLTESRVLKNTRHPF 230
            ||:..|:||||.:|||..||:.|   :.||:|||:|||..|:. :.:.|||..|..:|:..:|||
  Fly    76 DFELKKVLGKGGYGKVFQVRKTAGRDANKYFAMKVLKKASIVTNQKDTAHTRAERNILEAVKHPF 140

  Rat   231 LTSLKYSFQTKDRLCFVMEYVNGGELFFHLSRERVFSEDRTRFYGAEIVSALDYLHSGKIVYRDL 295
            :..|.|:|||..:|..::||::|||||.||.||.:|.||.|.||.:||:.||.:||...|:||||
  Fly   141 IVELVYAFQTDGKLYLILEYLSGGELFMHLEREGIFLEDTTCFYLSEIILALGHLHKLGIIYRDL 205

  Rat   296 KLENLMLDKDGHIKITDFGLCKEGITDAATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMY 360
            |.||::||..||:|:||||||||.|.:.....|||||.||:|||:|..:.:|:|||||.||.:|:
  Fly   206 KPENILLDAQGHVKLTDFGLCKEHIQEGIVTHTFCGTIEYMAPEILTRSGHGKAVDWWSLGALMF 270

  Rat   361 EMMCGRLPFYNQDHEKLFELILMEDIKFPRTLSSDAKSLLSGLLIKDPNKRLGGGPDDAKEIMRH 425
            :|:.|..||..::.:|..|.||...:..|..|:.:|:.|:..|:.:...:|||.||:||..:..|
  Fly   271 DMLTGVPPFTAENRKKTIETILKAKLNLPAYLTPEARDLVRRLMKRQEPQRLGSGPEDAAAVQIH 335

  Rat   426 SFFSGVNWQDVYDKKM 441
            .||..|||.||..:::
  Fly   336 PFFKHVNWDDVLARRL 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Akt3XP_038946556.1 PH_PKB 4..133 CDD:269947
PKc_like 175..442 CDD:419665 127/271 (47%)
S6kNP_001261450.1 PTZ00263 76..397 CDD:140289 129/276 (47%)
STKc_p70S6K 81..402 CDD:270736 127/271 (47%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100157
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.