DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Neurog1 and Fer3

DIOPT Version :9

Sequence 1:NP_062080.1 Gene:Neurog1 / 29410 RGDID:3167 Length:244 Species:Rattus norvegicus
Sequence 2:NP_524322.1 Gene:Fer3 / 41411 FlyBaseID:FBgn0037937 Length:195 Species:Drosophila melanogaster


Alignment Length:161 Identity:52/161 - (32%)
Similarity:74/161 - (45%) Gaps:40/161 - (24%)


- Green bases have known domain annotations that are detailed below.


  Rat     4 PLETCLSDLDCASSNSGSDLSSFLTDEEDCARLQPLASTSGLSVPARRSAPTLSGASNVPGGQDE 68
            |.:..::...|      :|||.:     ..:::.||       ||.|   |:.:|.:|   |...
  Fly    33 PYQELIAGFPC------TDLSLW-----QRSQVTPL-------VPQR---PSTNGRAN---GSSS 73

  Rat    69 EQERRRRRGRARVRSEALLHSLRRSRRVKANDRERNRMHNLNAALDALRSVLPSFPDDTKLTKIE 133
            ..::.||    ||.|.|        :|..||.|||.||.|||.|.|.||..:|:|..:.:|::||
  Fly    74 SSKKTRR----RVASMA--------QRRAANIRERRRMFNLNEAFDKLRRKVPTFAYEKRLSRIE 126

  Rat   134 TLRFAYNYIWALAETLRLADQGLPGGGARER 164
            |||.|..||..:||.|    .|.|....:.|
  Fly   127 TLRLAITYIGFMAELL----SGTPSNSHKSR 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Neurog1NP_062080.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 43..84 11/40 (28%)
bHLH_TS_NGN1_NeuroD3 83..154 CDD:381559 31/70 (44%)
Fer3NP_524322.1 HLH 87..135 CDD:278439 24/47 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.