DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Neurog1 and dimm

DIOPT Version :9

Sequence 1:NP_062080.1 Gene:Neurog1 / 29410 RGDID:3167 Length:244 Species:Rattus norvegicus
Sequence 2:NP_001260674.1 Gene:dimm / 35404 FlyBaseID:FBgn0023091 Length:390 Species:Drosophila melanogaster


Alignment Length:205 Identity:62/205 - (30%)
Similarity:89/205 - (43%) Gaps:34/205 - (16%)


- Green bases have known domain annotations that are detailed below.


  Rat    15 ASSNSGSDLSSFLTDEEDCARLQPLASTSGLSVPARRSAPTLSGASNVPGGQDEEQERRRRRGRA 79
            :::|:|......|..:....|.:...::||..........|.|.:||..|...     |||:|  
  Fly    90 STTNTGHPSGCSLGGQGPSGRGRVQQASSGACPSTIAPNSTSSNSSNANGNAS-----RRRKG-- 147

  Rat    80 RVRSEALLHSLRRSRRVKANDRERNRMHNLNAALDALRSVLPSFPDDTKLTKIETLRFAYNYIWA 144
                 ||....|..||:::|:|||.|||:||.|..:||.|:|....:.:|:|||||..|.|||..
  Fly   148 -----ALNAKERNMRRLESNERERMRMHSLNDAFQSLREVIPHVEMERRLSKIETLTLAKNYIIN 207

  Rat   145 L-----------AETLRLADQGLPGGGARERLLPPQCVPCLPGPPSPAS-------DTESWGSGA 191
            |           |..|.| :.|..||.....|......|...|.|:.::       ||.:.|   
  Fly   208 LTHIILSKRNEEAAALEL-NSGAVGGVLLSNLSSESGGPVASGIPANSNAATICFEDTLASG--- 268

  Rat   192 AASPCATVAS 201
            .|..||.:|:
  Fly   269 GAFDCAILAA 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Neurog1NP_062080.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 43..84 11/40 (28%)
bHLH_TS_NGN1_NeuroD3 83..154 CDD:381559 33/81 (41%)
dimmNP_001260674.1 HLH 154..208 CDD:238036 27/53 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3898
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19290
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.