DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bmp2 and scw

DIOPT Version :9

Sequence 1:NP_058874.2 Gene:Bmp2 / 29373 RGDID:2211 Length:394 Species:Rattus norvegicus
Sequence 2:NP_001286088.1 Gene:scw / 46000 FlyBaseID:FBgn0005590 Length:400 Species:Drosophila melanogaster


Alignment Length:417 Identity:105/417 - (25%)
Similarity:169/417 - (40%) Gaps:113/417 - (27%)


- Green bases have known domain annotations that are detailed below.


  Rat    39 RPLSRPSDDVLSEFELRLLSMFGLKQRP----TPSKDVVVPPYMLDLYRRHSGQPGAPAPDHRLE 99
            ||||.         ::.::.:..|..||    .|:.......::|::|...|.........|:..
  Fly    34 RPLSE---------QMEMIDILDLGDRPRRQAEPNLHNSASKFLLEVYNEISEDQEPKEVLHQRH 89

  Rat   100 RAA---------------SRANTVRSFHHEEAIEELPEMSGKTSRRFFFNLSSVPTDEFLTSAEL 149
            :.:               :..|::.:|......|:|   ..:......||.:.||.|..|..|.|
  Fly    90 KRSLDDDILISNEDRQEIASCNSILTFSSRLKPEQL---DNELDMHITFNTNDVPVDLSLVQAML 151

  Rat   150 QIFREQMQEALGNSSFQHRINIYEIIKPATASSKFPVTRLLDTR-------LVTQNTSQ----WE 203
            :|::   |.:|.:......:::|               |.||.|       |.:.||:.    |.
  Fly   152 RIYK---QPSLVDRRANFTVSVY---------------RKLDNRQDFSYRILGSVNTTSSQRGWL 198

  Rat   204 SFDVTPAVMRWTAQGHTNHGFVVEVAHLEEKPGVSKRH-VRIS----------RSLHQDEHSWSQ 257
            .|::|..:..|                |..| |:.:|: :|||          ..|...:.|.:.
  Fly   199 EFNLTDTLRYW----------------LHNK-GLQRRNELRISIGDSQLSTFAAGLVTPQASRTS 246

  Rat   258 VRPLLVTFGHDGKGHPLHKREKRQAKHKQRKRL-------------------KSSCKRHPLYVDF 303
            :.|.:|  |:......|.|.:|.:.|....||.                   ..||:|....|||
  Fly   247 LEPFIV--GYFNGPELLVKIQKLRFKRDLEKRRAGGGSPPPPPPPPVDLYRPPQSCERLNFTVDF 309

  Rat   304 SDVGWNDWIVAPPGYHAFYCHGECPFPLADHLNSTNHAIVQTLVNSVNSKIPKACCVPTELSAIS 368
            .::..::|::||..:.|::|.|.|.|||...:|:|||||||||::.....:||.|||||.|.||:
  Fly   310 KELHMHNWVIAPKKFEAYFCGGGCNFPLGTKMNATNHAIVQTLMHLKQPHLPKPCCVPTVLGAIT 374

  Rat   369 ML-YLDENEKVV-LKNYQDMVVEGCGC 393
            :| ||  ||.:: |..||..|.:.|||
  Fly   375 ILRYL--NEDIIDLTKYQKAVAKECGC 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Bmp2NP_058874.2 TGFb_propeptide 41..265 CDD:395559 48/264 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 269..291 6/40 (15%)
TGF_beta_BMP2 292..394 CDD:381660 48/104 (46%)
scwNP_001286088.1 TGFb_propeptide 39..254 CDD:279078 46/254 (18%)
TGFB 300..400 CDD:214556 47/102 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X157
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.