DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Chkb and eas

DIOPT Version :9

Sequence 1:XP_006242243.2 Gene:Chkb / 29367 RGDID:61826 Length:408 Species:Rattus norvegicus
Sequence 2:NP_523364.2 Gene:eas / 32585 FlyBaseID:FBgn0000536 Length:495 Species:Drosophila melanogaster


Alignment Length:384 Identity:113/384 - (29%)
Similarity:175/384 - (45%) Gaps:85/384 - (22%)


- Green bases have known domain annotations that are detailed below.


  Rat    58 GGAWRRARPEELSVCPVRSGVSLTLLRRRPQQPALPMLATEPRAQYGRGAPGGA-------ATAV 115
            ||::...:.:.||  ||:|           :.|.:.....:......|.|..|:       ...|
  Fly   155 GGSYLPIKTQGLS--PVQS-----------EDPVIIEKEDDDEFTDDRAADDGSPVQYSDNVVLV 206

  Rat   116 RGYLAGCRLLGIRKRDVRH--SCREISRAPTLWSVSRGPLGTVPPSY-WVQSRPLKTQELRDPVL 177
            |.|.....||..||.:.::  .......||:|::..:..|     .| :|....|.|..:..|.:
  Fly   207 RIYGNKTDLLIDRKAETQNFLLLHTYGLAPSLYATFKNGL-----VYEYVPGTTLNTDSVLCPEI 266

  Rat   178 SGAIATKMA------RFHG-------MEMPFTKEPRWL------FGTMERYLKQIQDLPSTSLPQ 223
            ...:|.:||      |.||       |.|.:.|...:|      |...|:: |::::   |.|| 
  Fly   267 WPLVARRMAEMHRKVRKHGDSSATKPMPMIWKKTQSFLDLVPERFSDAEKH-KRVKE---TFLP- 326

  Rat   224 MNLVEMYSLKDEMNHLRTLLDATPSPVVFCHNDIQEGNILLLSEPDSDDNLMLVDFEYSSYNYRG 288
                 :..|::|.|.|...|:|..||:||.|||:..||::.   ..|.:.:..:|:||:.||::.
  Fly   327 -----IGRLREEFNKLYEYLEALDSPIVFSHNDLLLGNVIY---TQSLNTVNFIDYEYADYNFQA 383

  Rat   289 FDIGNHFCEWV----YDYTYEEWPFYKARPADYPTREQQLLFIRHYLAE-VQKGEVLSEEEQKKQ 348
            |||||||.|..    .||            :.||.||.||.::|.||.| :|:..:     |..:
  Fly   384 FDIGNHFAEMCGVDEVDY------------SRYPKREFQLQWLRVYLEEYLQRSNI-----QNDE 431

  Rat   349 EEDLLIEISRYALASHFFWGLWSTLQASMSTIEFGYLEYAQSRFQFYFQQKGQLTSFLS 407
            .|.|.::::::|||||.||.:||.|||..|||:|.|:.||..|:..|..:|   ..|||
  Fly   432 VELLYVQVNQFALASHIFWTVWSLLQAEHSTIDFDYVGYAFLRYNEYLARK---VEFLS 487

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ChkbXP_006242243.2 PKc_like <162..399 CDD:304357 86/260 (33%)
easNP_523364.2 ETNK_euk 126..478 CDD:270706 108/370 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000493
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.