DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Serpine2 and Spn42Dd

DIOPT Version :9

Sequence 1:NP_062070.1 Gene:Serpine2 / 29366 RGDID:3748 Length:397 Species:Rattus norvegicus
Sequence 2:NP_001163067.1 Gene:Spn42Dd / 49808 FlyBaseID:FBgn0028988 Length:372 Species:Drosophila melanogaster


Alignment Length:387 Identity:123/387 - (31%)
Similarity:201/387 - (51%) Gaps:36/387 - (9%)


- Green bases have known domain annotations that are detailed below.


  Rat    25 LSLEELGSDTGIQVFNQIIKSQPHENVVISPHGIASILGMLQLGADGRTKKQLSTVM-------- 81
            |.:..:...|..:::..:.||..::|:|:||..|.:||.|:.:||:|.|.|:|.:.:        
  Fly     8 LWVTSVACQTSKEIYQLLSKSHTNQNLVVSPVSIETILSMVFMGAEGSTAKELQSALGLPSEDKE 72

  Rat    82 ----RYNVNGVGKVLKKINKAIVSKKNKDIVTVANAVFVRNGFKVEVPFAARNKEVFQCEVQSVN 142
                ||     |.:|..:.    .::...|:.:||.::|.:.:.:...:....:|.|:.|.:|::
  Fly    73 AVAARY-----GALLNDLQ----GQEEGPILKLANRIYVNDQYSLNQNYNLAVREPFKSEAESIS 128

  Rat   143 FQDPASACDAINFWVKNETRGMIDNLLSPNLIDSALTKLVLVNAVYFKGLWKSRFQPENTKKRTF 207
            ..:...|.:.||.||.::|.|.|..::.|..:.|.: |.:||||:||||.|:|:|.|..|:..||
  Fly   129 LTNGPVAAERINQWVLDQTSGKIKGMIDPGSMTSDV-KALLVNAIYFKGQWESKFDPAKTRASTF 192

  Rat   208 VAGDGKSYQVPMLAQLSVFRSGSTKTPNGLWYNFIELPYHGESISMLIALPTESSTPLSAIIPHI 272
            .....||..|.|:||:..||:...:   .|....|||||...::||.|.||.|.. .|||:    
  Fly   193 QVTANKSVPVQMMAQMGTFRANYFR---DLDAQVIELPYLNSNLSMTIFLPREVE-GLSAL---- 249

  Rat   273 STKTINSWMNTMVPKRMQLVLPKFTAVAQTDLKEPLKALGITEMFEPSKANFAKITRSES-LHVS 336
             .:.|..:...:|.|.:.|.||||....:.:|||.|:.|||.|:| ..|::.:.:...:| ..||
  Fly   250 -EEKIVGFARPLVAKEVYLKLPKFKIEFRDELKETLEKLGIRELF-TDKSDLSGLFADKSGGKVS 312

  Rat   337 HILQKAKIEVSEDGTKAAVVTTAILIARSSPPWFIV-DRPFLFCIRHNPTGAILFLGQVNKP 397
            .:..||.:||:|:|.:||..|:..:..|:....|:: |.||.|.||...|  |.|.|:|..|
  Fly   313 QVSHKAFLEVNEEGAEAAGATSVAVTNRAGFSTFLMADHPFAFVIRDANT--IYFQGRVVSP 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Serpine2NP_062070.1 serpinE2_GDN 21..395 CDD:381039 121/383 (32%)
Spn42DdNP_001163067.1 SERPIN 16..369 CDD:238101 120/374 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm12319
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
66.030

Return to query results.
Submit another query.