DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Serpine2 and Spn88Eb

DIOPT Version :9

Sequence 1:NP_062070.1 Gene:Serpine2 / 29366 RGDID:3748 Length:397 Species:Rattus norvegicus
Sequence 2:NP_650427.1 Gene:Spn88Eb / 41829 FlyBaseID:FBgn0038299 Length:426 Species:Drosophila melanogaster


Alignment Length:427 Identity:113/427 - (26%)
Similarity:188/427 - (44%) Gaps:54/427 - (12%)


- Green bases have known domain annotations that are detailed below.


  Rat     9 ILTTVTLSSV----YSQLNSLSLEELGS-DTGIQVFNQIIKSQPHENVVISPHGIASILGMLQLG 68
            :|..||::::    .|.||..|....|. |..:.:..||.:..|..|:..||....:.|.:....
  Fly    11 LLPVVTIAALDKPELSFLNEFSQIFKGERDFSLALMKQIREIYPSGNLFFSPFSTYNALLLAYFS 75

  Rat    69 ADGRTKKQLSTVMRYNVNGVGKVLKKINKAIVS------------KKNKDIVTVANAVFVRNGFK 121
            :..:|:::|:..:     .:|..|.| .:.:||            :::...::.||.:||.....
  Fly    76 SSEQTERELAQAL-----NLGWALNK-QQVLVSYTLAQRQDEFRWRQSPMELSSANRIFVDRTIN 134

  Rat   122 VEVPFAARNKEVFQCEVQSVNFQ-DPASACDAINFWVKNETRGMIDNLLSPNLIDSALTKLVLVN 185
            |...|    ..:.....:.::|: ||.:....||.|:.::|...|.::||...| :..|.|||.|
  Fly   135 VSNKF----NTLLYGATKELDFKNDPETGLKEINDWIADKTHNQIRDMLSSEEI-TPHTMLVLAN 194

  Rat   186 AVYFKGLWKSRFQPENTKKRTFVAGDGKSYQVPMLAQLSVFRSGSTKTPNGLWYNFIELPYH--- 247
            |.|.||.|.|:|:.|.|..:.|...:.:...|.|:.:...|:   .....||....|:|||.   
  Fly   195 AAYMKGQWLSQFKVEETALKPFFINEREQEMVYMMHKTGAFK---MTIDEGLQSQIIKLPYRTIY 256

  Rat   248 ------------GESISMLIALPTESSTPLSAIIPHISTKTINSWMNTMVPKRMQLVLPKFTAVA 300
                        ...|||:|.||..:...|:.:|..::..::..|....:|::::|.||||....
  Fly   257 KSKETHISTPESKSDISMIIILPNSNKISLNRVISRLNADSVKKWFERALPQKIELSLPKFQFEQ 321

  Rat   301 QTDLKEPLKALGITEMFEPSKANFAKITRSE-SLHVSHILQKAKIEVSEDGTKAAVVTTAILIAR 364
            :.:|...|..:|:..|| ...|.|..:|... ||.:......|||:|.|.|:.|| ..|.:|::|
  Fly   322 RLELTPILSLMGVNTMF-TRNATFGDLTADPISLVIDDAQHLAKIKVDEVGSTAA-AATILLVSR 384

  Rat   365 SS----PPWFIVDRPFLFCIRHNPTGAILFLGQVNKP 397
            ||    |..|..:.||:|.|.......|||.|..:.|
  Fly   385 SSRQPDPTKFNCNHPFVFLIYDEKVDTILFAGVYSDP 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Serpine2NP_062070.1 serpinE2_GDN 21..395 CDD:381039 108/407 (27%)
Spn88EbNP_650427.1 SERPIN 37..418 CDD:238101 105/396 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.