DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tef and Irbp18

DIOPT Version :9

Sequence 1:NP_062067.2 Gene:Tef / 29362 RGDID:3841 Length:301 Species:Rattus norvegicus
Sequence 2:NP_001261698.1 Gene:Irbp18 / 39243 FlyBaseID:FBgn0036126 Length:113 Species:Drosophila melanogaster


Alignment Length:65 Identity:18/65 - (27%)
Similarity:33/65 - (50%) Gaps:0/65 - (0%)


- Green bases have known domain annotations that are detailed below.


  Rat   231 DEKYWTRRKKNNVAAKRSRDARRLKENQITIRAAFLEKENTALRTEVAELRKEVGKCKTIVSKYE 295
            |..|..:|||||.|.:|:|:..:....:...|...|.|:|.||:.::....|.:...:.::.:.|
  Fly    25 DPAYKEKRKKNNEAVQRTREKTKKSAEERKKRIDDLRKQNDALKVQIETSEKHISTLRDLIIQGE 89

  Rat   296  295
              Fly    90  89

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TefNP_062067.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..70
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 130..174
bZIP_HLF 230..288 CDD:269843 17/56 (30%)
Basic motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 233..253 9/19 (47%)
Leucine-zipper. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 254..261 0/6 (0%)
Irbp18NP_001261698.1 bZIP_CEBP 24..83 CDD:269841 17/57 (30%)
coiled coil 25..83 CDD:269841 17/57 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3119
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.