DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zfp36l1 and Tis11

DIOPT Version :9

Sequence 1:NP_058868.1 Gene:Zfp36l1 / 29344 RGDID:62009 Length:338 Species:Rattus norvegicus
Sequence 2:NP_001259490.1 Gene:Tis11 / 32222 FlyBaseID:FBgn0011837 Length:436 Species:Drosophila melanogaster


Alignment Length:400 Identity:128/400 - (32%)
Similarity:180/400 - (45%) Gaps:89/400 - (22%)


- Green bases have known domain annotations that are detailed below.


  Rat    11 FDLSEVLCKGNKMLNYSTPSAGGCLLDRKAVGTP--AGGGFPRRHSVTLPSSKFHQNQLLSSLKG 73
            ||.:||. |..:||     .|.|..||::....|  ..||..|  :::.|:....|.|.....:.
  Fly    36 FDCNEVR-KEIRML-----LAHGANLDQQHQQQPHRHHGGLTR--TISQPAQLIQQQQQQHQQQQ 92

  Rat    74 EPAPTLSSRDSRFRDRSFSEGGERLLPTQKQPGSGQ--VNSSRYKTELCRPFEENGACKYGDKCQ 136
            :..|.::|..:...:........:|..||.:|...|  :|:|||||||||||||.|.||||:|||
  Fly    93 QQQPAVASLVTITENLGNMNLHRKLERTQSEPLPPQQPMNTSRYKTELCRPFEEAGECKYGEKCQ 157

  Rat   137 FAHGIHELRSLTRHPKYKTELCRTFHTIGFCPYGPRCHFIHNAEERRA-----LAGGRDLSADRP 196
            ||||.||||::.||||||||.|||||::|||||||||||:|||:|.||     .|.....|..:.
  Fly   158 FAHGSHELRNVHRHPKYKTEYCRTFHSVGFCPYGPRCHFVHNADEARAQQAAQAAKSSTQSQSQS 222

  Rat   197 RLQHSFSFAGFPSAAATAAATGLLDSPTS---------------------ITPPPILSADDLLGS 240
            :...|.:|:...:.::..::.....|.:|                     ::||..:|......|
  Fly   223 QQSSSQNFSPKSNQSSNQSSNSSSSSSSSGGGGGGGNSINNNNGSQFYLPLSPPLSMSTGSDRES 287

  Rat   241 PT-----LPDGTNNPFAF----------------SSQELASLFAPSMGL---------------- 268
            ||     .|..:...|.|                :|...::..|..|||                
  Fly   288 PTGSLSLSPTNSLTSFPFHDALQHGYLASNGAKSNSSASSTSSASGMGLGMSMGIGQGMIIGQGL 352

  Rat   269 -PGGGSPTTFLFRPMSESPHMFDSP---PSPQDSLSDHEGYLSSSSSS-----HSGSDSPTLDNS 324
             .|...|.|     ..|||::..||   |.|.|.:....|..::|..|     .|.|.....:::
  Fly   353 GMGHHGPAT-----PPESPNVPISPVHTPPPYDVVVSGSGAGNNSVGSKQLLQKSVSTPMQQEDT 412

  Rat   325 RRLPIFSRLS 334
            .|||:|:|||
  Fly   413 PRLPVFNRLS 422

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zfp36l1NP_058868.1 Necessary and sufficient for the association with mRNA decay enzymes and mRNA decay activation. /evidence=ECO:0000250|UniProtKB:Q07352 1..111 25/103 (24%)
Tis11B_N 1..105 CDD:398311 23/95 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 93..113 6/21 (29%)
CTH1 <115..>177 CDD:227395 51/61 (84%)
Necessary for mRNA decay activation. /evidence=ECO:0000250|UniProtKB:Q07352 185..338 42/216 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 273..338 21/69 (30%)
Tis11NP_001259490.1 zf-CCCH 136..161 CDD:279036 21/24 (88%)
zf-CCCH 174..198 CDD:279036 20/23 (87%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 61 1.000 Domainoid score I10179
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000616
OrthoInspector 1 1.000 - - otm45321
orthoMCL 1 0.900 - - OOG6_101179
Panther 1 1.100 - - LDO PTHR12547
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.910

Return to query results.
Submit another query.