DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GSK3A and gsk-3

DIOPT Version :9

Sequence 1:NP_063937.2 Gene:GSK3A / 2931 HGNCID:4616 Length:483 Species:Homo sapiens
Sequence 2:NP_001379044.1 Gene:gsk-3 / 173149 WormBaseID:WBGene00001746 Length:362 Species:Caenorhabditis elegans


Alignment Length:328 Identity:250/328 - (76%)
Similarity:286/328 - (87%) Gaps:2/328 - (0%)


- Green bases have known domain annotations that are detailed below.


Human    97 SGK-VTTVVATLG-QGPERSQEVAYTDIKVIGNGSFGVVYQARLAETRELVAIKKVLQDKRFKNR 159
            ||| ||.|||::. .|.::..|::|.|.|||||||||||:.|:|:.|.|:|||||||||||||||
 Worm    12 SGKQVTMVVASVATDGVDQQVEISYYDQKVIGNGSFGVVFLAKLSTTNEMVAIKKVLQDKRFKNR 76

Human   160 ELQIMRKLDHCNIVRLRYFFYSSGEKKDELYLNLVLEYVPETVYRVARHFTKAKLTIPILYVKVY 224
            ||||||||:|.|||:|:|||||||||||||||||:||||||||||||||::|.:..||::|||:|
 Worm    77 ELQIMRKLNHPNIVKLKYFFYSSGEKKDELYLNLILEYVPETVYRVARHYSKQRQQIPMIYVKLY 141

Human   225 MYQLFRSLAYIHSQGVCHRDIKPQNLLVDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPE 289
            ||||.||||||||.|:|||||||||||:||::.|||||||||||.|||.||||||||||||||||
 Worm   142 MYQLLRSLAYIHSIGICHRDIKPQNLLIDPESGVLKLCDFGSAKYLVRNEPNVSYICSRYYRAPE 206

Human   290 LIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEF 354
            ||||||:||:||||||||.|:||||||||||||||||||||||||||||||||||:.|||||.||
 Worm   207 LIFGATNYTNSIDVWSAGTVMAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIQSMNPNYKEF 271

Human   355 KFPQIKAHPWTKVFKSRTPPEAIALCSSLLEYTPSSRLSPLEACAHSFFDELRCLGTQLPNNRPL 419
            ||||||||||.|||:..||.|||.|.|.::||||:||.:|..||.|:||||||....:||:.|||
 Worm   272 KFPQIKAHPWNKVFRVHTPAEAIDLISKIIEYTPTSRPTPQAACQHAFFDELRNPDARLPSGRPL 336

Human   420 PPL 422
            |.|
 Worm   337 PTL 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GSK3ANP_063937.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..96
STKc_GSK3 114..406 CDD:271039 231/291 (79%)
Pkinase 119..403 CDD:278497 227/283 (80%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 449..483
gsk-3NP_001379044.1 STKc_GSK3 31..323 CDD:271039 231/291 (79%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C161454042
Domainoid 1 1.000 482 1.000 Domainoid score I210
eggNOG 1 0.900 - - E2759_KOG0658
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 524 1.000 Inparanoid score I733
Isobase 1 0.950 - 0 Normalized mean entropy S376
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D328711at33208
OrthoFinder 1 1.000 - - FOG0000635
OrthoInspector 1 1.000 - - otm15589
orthoMCL 1 0.900 - - OOG6_100482
Panther 1 1.100 - - LDO PTHR24057
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R530
SonicParanoid 1 1.000 - - X378
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1413.780

Return to query results.
Submit another query.