DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arl4a and Arf102F

DIOPT Version :9

Sequence 1:NP_062059.1 Gene:Arl4a / 29308 RGDID:2152 Length:200 Species:Rattus norvegicus
Sequence 2:NP_001259087.1 Gene:Arf102F / 43823 FlyBaseID:FBgn0013749 Length:180 Species:Drosophila melanogaster


Alignment Length:181 Identity:76/181 - (41%)
Similarity:116/181 - (64%) Gaps:6/181 - (3%)


- Green bases have known domain annotations that are detailed below.


  Rat     9 TSILSSLPSFQSFHIVILGLDCAGKTTVLYRLQFNEFVNTVPTKGFNTEKIKVTLGNSKTVTFHF 73
            :|:|:.|...:...|:::|||.|||||:||:|:..|.|.|:||.|||.|.::.     |.:.|..
  Fly     6 SSLLTRLFGKKQMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEY-----KNICFTV 65

  Rat    74 WDVGGQEKLRPLWKSYTRCTDGIVFVVDSVDVERMEEAKTELHKITRISENQGVPVLIVANKQDL 138
            ||||||:|:||||:.|.:.|.|::|||||.|.:|:.||:.||..:.:..|.:...:|:.||||||
  Fly    66 WDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRITEAERELQNMLQEDELRDAVLLVFANKQDL 130

  Rat   139 RNSLSLSEIEKLLAMGELSSSTPWHLQPTCAIIGDGLKEGLEKLHDMIIKR 189
            .|:::.:|:...|.:.:| .:..|.:|.|||..|.||.|||:.|...:.|:
  Fly   131 PNAMTAAELTDKLRLNQL-RNRHWFIQSTCATQGHGLYEGLDWLSAELAKK 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arl4aNP_062059.1 Arl4_Arl7 18..200 CDD:206719 73/172 (42%)
Arf102FNP_001259087.1 YlqF_related_GTPase 1..180 CDD:424112 75/179 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0070
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.