DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mesp2 and CG33557

DIOPT Version :9

Sequence 1:NP_001099743.1 Gene:Mesp2 / 293046 RGDID:1305959 Length:368 Species:Rattus norvegicus
Sequence 2:NP_001014730.1 Gene:CG33557 / 3346145 FlyBaseID:FBgn0053557 Length:150 Species:Drosophila melanogaster


Alignment Length:117 Identity:37/117 - (31%)
Similarity:54/117 - (46%) Gaps:29/117 - (24%)


- Green bases have known domain annotations that are detailed below.


  Rat    34 ASSSDSSGSCPCYATRPPSQSTGPARSARNTQVAPNAPRRARPAPAGGQ-----------RQSAS 87
            |..|:||||         :..:|.|..:.::|:.    :.|.|   |||           ||..:
  Fly    19 AQDSNSSGS---------ASGSGAAADSEDSQIG----QEANP---GGQENQGNHRRRPPRQKIN 67

  Rat    88 EREKLRMRTLARALQELRRFLPPSVAPAGQSLTKIETLRLAIRYIGHLSALL 139
            .||:.|...:..|.:.||..:|  ..|..:.|:|||.:|||..||.|||:.|
  Fly    68 ARERYRTFNVNSAYEALRNLIP--TEPMNRKLSKIEIIRLASSYITHLSSTL 117

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mesp2NP_001099743.1 HLH 82..135 CDD:278439 20/63 (32%)
CG33557NP_001014730.1 HLH 67..119 CDD:197674 21/53 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.