DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rps19l2 and RpS19a

DIOPT Version :9

Sequence 1:NP_001032423.1 Gene:Rps19l2 / 29287 RGDID:68440 Length:145 Species:Rattus norvegicus
Sequence 2:NP_001285338.1 Gene:RpS19a / 32635 FlyBaseID:FBgn0010412 Length:156 Species:Drosophila melanogaster


Alignment Length:138 Identity:91/138 - (65%)
Similarity:107/138 - (77%) Gaps:0/138 - (0%)


- Green bases have known domain annotations that are detailed below.


  Rat     1 MPGVTVKDVNQQEFVRALAAFLKKSGKLKVPEWVDTVKLAKHKELAPYDENWFYTRAASTARHLY 65
            ||||||||::|....:|:|.||||:||||||:.:|.||.||.|||||||.:|||.|.||..||||
  Fly     1 MPGVTVKDIDQHAVTKAVAVFLKKTGKLKVPDQMDIVKTAKFKELAPYDPDWFYVRCASILRHLY 65

  Rat    66 LRGGAGVGSMTKIYGGRQRNGVRPSHFSRGSKSVARRVLQALEGLKMVEKDQDGGRKLTPQGQRD 130
            .|..|||||:|||||||:||||.||||.|.:...||:.|||||..::|||..||||||:..||||
  Fly    66 HRSPAGVGSITKIYGGRKRNGVHPSHFCRAADGAARKALQALEHARLVEKHPDGGRKLSSIGQRD 130

  Rat   131 LDRIAGQV 138
            |||||.|:
  Fly   131 LDRIANQI 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rps19l2NP_001032423.1 Ribosomal_S19e 5..141 CDD:395866 87/134 (65%)
RpS19aNP_001285338.1 Ribosomal_S19e 5..138 CDD:279436 86/132 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 178 1.000 Domainoid score I3457
eggNOG 1 0.900 - - E1_COG2238
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 187 1.000 Inparanoid score I3820
OMA 1 1.010 - - QHG62169
OrthoDB 1 1.010 - - D1434984at2759
OrthoFinder 1 1.000 - - FOG0001026
OrthoInspector 1 1.000 - - mtm9051
orthoMCL 1 0.900 - - OOG6_100904
Panther 1 1.100 - - LDO PTHR11710
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X617
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1312.880

Return to query results.
Submit another query.