DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GSC2 and Antp

DIOPT Version :9

Sequence 1:NP_005306.1 Gene:GSC2 / 2928 HGNCID:4613 Length:205 Species:Homo sapiens
Sequence 2:NP_996167.1 Gene:Antp / 40835 FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster


Alignment Length:230 Identity:52/230 - (22%)
Similarity:77/230 - (33%) Gaps:64/230 - (27%)


- Green bases have known domain annotations that are detailed below.


Human     1 MAAAAGGAASRRGAGRPCP----FSIEHILSSLPERSLPARAACPPQPAGRQSPAKP-------- 53
            :.||.||.......|.| |    .|..|:.:.:   :||.....|....|......|        
  Fly   164 LQAAVGGLGMVPEGGSP-PLVDQMSGHHMNAQM---TLPHHMGHPQAQLGYTDVGVPDVTEVHQN 224

Human    54 --------EEPGAPEAAPCACCCCCGPRAAP--------CGPPEAAAGLGARLAWPLRLGPAVPL 102
                    ::.|.|            |..||        .|||:...|         ..|...|.
  Fly   225 HHNMGMYQQQSGVP------------PVGAPPQGMMHQGQGPPQMHQG---------HPGQHTPP 268

Human   103 SLGAPAGGSGALPGAVGP------GSQRRTRRHRTIFSEEQLQALEALFVQNQYPDVSTRERLAG 161
            |.. |...|..:|..:.|      |..:..:|.|..::..|...||..|..|:|.....|..:|.
  Fly   269 SQN-PNSQSSGMPSPLYPWMRSQFGKCQERKRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAH 332

Human   162 RIRLREERVEVWFKNRRAKWRHQKRASASARLLPG 196
            .:.|.|.::::||:|||.||:.:.:....    ||
  Fly   333 ALCLTERQIKIWFQNRRMKWKKENKTKGE----PG 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GSC2NP_005306.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 33..58 5/40 (13%)
Homeobox 129..182 CDD:278475 17/52 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 185..205 2/12 (17%)
AntpNP_996167.1 KLF1_2_4_N <161..306 CDD:425360 33/167 (20%)
Homeobox 301..354 CDD:395001 18/52 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.