DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Meox2 and Ubx

DIOPT Version :9

Sequence 1:NP_058845.2 Gene:Meox2 / 29279 RGDID:3079 Length:303 Species:Rattus norvegicus
Sequence 2:NP_536752.1 Gene:Ubx / 42034 FlyBaseID:FBgn0003944 Length:389 Species:Drosophila melanogaster


Alignment Length:240 Identity:65/240 - (27%)
Similarity:89/240 - (37%) Gaps:68/240 - (28%)


- Green bases have known domain annotations that are detailed below.


  Rat   104 RHSLCLQPD---------SGGPP------ELGSSPPVLCSNSSS---------LGSSTPTGAACA 144
            |.|.| .||         |||.|      ..|.:..|...|.::         .|:.|...|.|.
  Fly   154 RPSAC-TPDSRVGGYLDTSGGSPVSHRGGSAGGNVSVSGGNGNAGGVQSGVGVAGAGTAWNANCT 217

  Rat   145 PGDYGRQALSPAEVEKRSG-----------------SKRKSDSSDSQEGNYKSEV---------- 182
            ......|..:.:.:.:.|.                 :|.|..|..:|.|...:::          
  Fly   218 ISGAAAQTAAASSLHQASNHTFYPWMAIAGECPEDPTKSKIRSDLTQYGGISTDMGKRYSESLAG 282

  Rat   183 ---------NSKPRKERTAFTKEQIRELEAEFAHHNYLTRLRRYEIAVNLDLTERQVKVWFQNRR 238
                     |...|:.|..:|:.|..|||.||..::||||.||.|:|..|.|||||:|:||||||
  Fly   283 SLLPDWLGTNGLRRRGRQTYTRYQTLELEKEFHTNHYLTRRRRIEMAHALCLTERQIKIWFQNRR 347

  Rat   239 MKWKRVKGGQQGAAAREKELVNVKKGTLLPSELSGIGAATLQQTG 283
            ||.|:       .....|||...:|........:...||...|.|
  Fly   348 MKLKK-------EIQAIKELNEQEKQAQAQKAAAAAAAAAAVQGG 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Meox2NP_058845.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 63..191 25/146 (17%)
Homeobox 190..243 CDD:395001 31/52 (60%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 279..303 2/5 (40%)
UbxNP_536752.1 Homeobox 299..352 CDD:395001 31/52 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.