DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Meox2 and Antp

DIOPT Version :10

Sequence 1:NP_058845.2 Gene:Meox2 / 29279 RGDID:3079 Length:303 Species:Rattus norvegicus
Sequence 2:NP_996167.1 Gene:Antp / 40835 FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster


Alignment Length:280 Identity:77/280 - (27%)
Similarity:106/280 - (37%) Gaps:81/280 - (28%)


- Green bases have known domain annotations that are detailed below.


  Rat    12 PHATAQGLHPFSQ-------SSLALHGRSDHMS-YPELSTSSSSCIIAGYPNEEGMFASQHHRGH 68
            |..|.|..||..|       :|..|......:. .||..:......::|: :........||.||
  Fly   140 PQVTQQVTHPQQQQQQPVVYASCKLQAAVGGLGMVPEGGSPPLVDQMSGH-HMNAQMTLPHHMGH 203

  Rat    69 H-----------------HHHHHHHHHHQQQQHQALQSNWHLPQMSSPPSAARHSLCLQPDSGGP 116
            .                 |.:||:...:|||.        .:|.:.:||....|      ...||
  Fly   204 PQAQLGYTDVGVPDVTEVHQNHHNMGMYQQQS--------GVPPVGAPPQGMMH------QGQGP 254

  Rat   117 PELGS------SPPVLCSNSSSLGSSTPTGAACAPGDYGRQALSPAEVEKRSGSKRKSDSSDSQE 175
            |::..      :||....||.|.|..:|              |.|         ..:|.....||
  Fly   255 PQMHQGHPGQHTPPSQNPNSQSSGMPSP--------------LYP---------WMRSQFGKCQE 296

  Rat   176 GNYKSEVNSKPRKERTAFTKEQIRELEAEFAHHNYLTRLRRYEIAVNLDLTERQVKVWFQNRRMK 240
                      .::.|..:|:.|..|||.||..:.||||.||.|||..|.|||||:|:||||||||
  Fly   297 ----------RKRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMK 351

  Rat   241 WKRVK--GGQQGAAAREKEL 258
            ||:..  .|:.|:.....|:
  Fly   352 WKKENKTKGEPGSGGEGDEI 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Meox2NP_058845.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 63..191 29/150 (19%)
Homeodomain 187..243 CDD:459649 33/55 (60%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 279..303
AntpNP_996167.1 KLF1_2_4_N <161..306 CDD:425360 35/192 (18%)
Homeodomain 298..354 CDD:459649 33/55 (60%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.