DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Meox2 and ftz

DIOPT Version :9

Sequence 1:NP_058845.2 Gene:Meox2 / 29279 RGDID:3079 Length:303 Species:Rattus norvegicus
Sequence 2:NP_477498.1 Gene:ftz / 40834 FlyBaseID:FBgn0001077 Length:410 Species:Drosophila melanogaster


Alignment Length:173 Identity:57/173 - (32%)
Similarity:78/173 - (45%) Gaps:48/173 - (27%)


- Green bases have known domain annotations that are detailed below.


  Rat    81 QQQHQALQSNWHLPQMSSPPSAARHSLCLQPDSGGPPELG-SSPPVLCSNSSSLGSS-------- 136
            |.|.|.|::.    ..::||.....||        ||..| |:||......||...|        
  Fly   177 QSQTQKLKNG----DFATPPPTTPTSL--------PPLEGISTPPQSPGEKSSSAVSQEINHRIV 229

  Rat   137 -TPTGAACAPGDYGRQALSPAEVEKRSGSKRKSDSSDSQEGNYKSEVNSKPRKERTAFTKEQIRE 200
             .|.||    ||:     :.:.:|:...    ||..||             ::.|..:|:.|..|
  Fly   230 TAPNGA----GDF-----NWSHIEETLA----SDCKDS-------------KRTRQTYTRYQTLE 268

  Rat   201 LEAEFAHHNYLTRLRRYEIAVNLDLTERQVKVWFQNRRMKWKR 243
            ||.||..:.|:||.||.:||..|.|:|||:|:||||||||.|:
  Fly   269 LEKEFHFNRYITRRRRIDIANALSLSERQIKIWFQNRRMKSKK 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Meox2NP_058845.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 63..191 27/119 (23%)
Homeobox 190..243 CDD:395001 29/52 (56%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 279..303
ftzNP_477498.1 FTZ 1..248 CDD:281812 23/91 (25%)
Homeobox 257..310 CDD:278475 29/52 (56%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.