DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sell and lectin-22C

DIOPT Version :9

Sequence 1:XP_038946544.1 Gene:Sell / 29259 RGDID:3655 Length:460 Species:Rattus norvegicus
Sequence 2:NP_001137766.1 Gene:lectin-22C / 7354375 FlyBaseID:FBgn0259230 Length:263 Species:Drosophila melanogaster


Alignment Length:123 Identity:34/123 - (27%)
Similarity:57/123 - (46%) Gaps:18/123 - (14%)


- Green bases have known domain annotations that are detailed below.


  Rat    99 YHYSER--SMNWENARKFCKHNYTDLVAIQNKREIEYLEKTLPKNPTYYWIGIRKI---GKTWTW 158
            |:|.|:  ..||..|.|.|::....|..|:::.::..::..| |..|:||:||..:   ||..:.
  Fly   146 YYYIEKVSEKNWSTASKTCRNMGGHLADIKDEADLAAIKANL-KEDTHYWLGINDLDHEGKFLSM 209

  Rat   159 -VGTNKTLTKEAENWGTGEPNNKKSKEDCVEIYIKRERDSGKWNDDACHKRKAALCYT 215
             .|...|..|    |.:|.|:...:. :||.:|      :|:..|..||.....:|.|
  Fly   210 PTGKQTTFLK----WASGRPSQLDTL-NCVFLY------NGEMYDYPCHYTFRFICQT 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SellXP_038946544.1 CLECT_selectins_like 97..215 CDD:153062 33/121 (27%)
EGF_CA 218..250 CDD:238011
CCP 255..313 CDD:153056
PHA02817 275..>384 CDD:165167
lectin-22CNP_001137766.1 CLECT 146..255 CDD:153057 32/120 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.