DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sell and hig

DIOPT Version :9

Sequence 1:XP_038946544.1 Gene:Sell / 29259 RGDID:3655 Length:460 Species:Rattus norvegicus
Sequence 2:NP_724773.1 Gene:hig / 35949 FlyBaseID:FBgn0010114 Length:958 Species:Drosophila melanogaster


Alignment Length:449 Identity:94/449 - (20%)
Similarity:137/449 - (30%) Gaps:175/449 - (38%)


- Green bases have known domain annotations that are detailed below.


  Rat     9 GWRNER--KQALL----VTLGTFFLSAAHPPCARAQR--------------------PRCRRLRP 47
            |||..|  |..||    :.:| :.|...|...||.|.                    ||.....|
  Fly   536 GWRKTRLSKSTLLSNTEINVG-WDLPHGHSLQARCQELGIYKLLGESRVLCSNGLWAPRMPSCVP 599

  Rat    48 AEGLTEETQQA------MVFPWRCQSAQRGSWSFLKLWIWTLLCCDLLPHHGT---HC------- 96
            ...||..::.:      .:|        .||.||....:..      :|.|.|   .|       
  Fly   600 TTVLTNYSEDSAPSIRIKIF--------NGSHSFEPSGVMA------VPPHSTVLMDCMYPRVRG 650

  Rat    97 -----WTYHYSERSMNWENARKFCKHNYTDLVAIQNKREIEYLEKTLPKNPTYYWIGIRKIGKTW 156
                 ||..|.:.|..|..|              |.::.:.|                       
  Fly   651 TPEWSWTSWYMQYSTGWSPA--------------QEEKAVRY----------------------- 678

  Rat   157 TWVGTNKTLTKEAENWGTGEPNNKKSKEDCVEIYIKRERDSGKWNDDACHKRK------AALCYT 215
                  :...|..||                       .|||.:   .|...:      |.:..|
  Fly   679 ------RLSIKNIEN-----------------------NDSGTF---TCTSPRGLTNSIAVVVAT 711

  Rat   216 ASCQPE-----------------SCNRHGECVETIN-----NNTCICDPGYYG--PQCQYVIQCE 256
            ::| |:                 ....|.||.|...     |.||:....:..  |.| :.|||.
  Fly   712 STC-PQLTEPLAPLKLRLEGNKLGQRAHYECPEGFRLDGAWNATCLASGNWSSPTPTC-HAIQCP 774

  Rat   257 PLKA--PELGTMNCIHPLGDFSFQSQCAFNCSEGSELLGNAKTECGASGNWTYLEPICQVIQCMP 319
            .|:.  |.|..:..     :.|...:..|.|..|.:|.|.|:.:|..||.|:...|.|:||||:.
  Fly   775 RLELDDPHLSLIEL-----NTSAWGRAVFKCQWGFKLTGPAQLDCEPSGVWSGPVPRCKVIQCVM 834

  Rat   320 LAAP---DLGTMECSHPLANFSFTSACTFTCSEETDLIGERKTVCRSSGSWSSPSPICQ 375
            ..||   .:|....|.  ...:..:..||:|::...|:||...:|..:|.||...|.|:
  Fly   835 PVAPLNGRIGGTSLSQ--RRLTVGALVTFSCNDGHSLVGESSIICTENGQWSHSPPFCK 891

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SellXP_038946544.1 CLECT_selectins_like 97..215 CDD:153062 16/123 (13%)
EGF_CA 218..250 CDD:238011 10/55 (18%)
CCP 255..313 CDD:153056 16/59 (27%)
PHA02817 275..>384 CDD:165167 33/104 (32%)
higNP_724773.1 PHA02927 705..952 CDD:222943 52/196 (27%)
CCP 714..768 CDD:153056 10/54 (19%)
CCP <795..828 CDD:153056 11/32 (34%)
CCP 832..891 CDD:153056 16/60 (27%)
Sushi 894..952 CDD:278512
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 44 1.000 Domainoid score I11952
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19325
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.