DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Oprl1 and AstC-R1

DIOPT Version :9

Sequence 1:NP_001305876.1 Gene:Oprl1 / 29256 RGDID:68438 Length:396 Species:Rattus norvegicus
Sequence 2:NP_649040.2 Gene:AstC-R1 / 40020 FlyBaseID:FBgn0036790 Length:483 Species:Drosophila melanogaster


Alignment Length:414 Identity:142/414 - (34%)
Similarity:213/414 - (51%) Gaps:35/414 - (8%)


- Green bases have known domain annotations that are detailed below.


  Rat     2 ESLFPAPY---WEVLYGSHFQGNLSLLNETVPHHLLLNASHSAFLPLGLKVTIVGLYLAVCIGGL 63
            |||:....   | :...|..|...||....:|.:....|:.::|..|   .|:| ||..|||.||
  Fly    33 ESLYTTELNHRW-ISGSSTIQPEESLYGTDLPTYQHCIATRNSFADL---FTVV-LYGFVCIIGL 92

  Rat    64 LGNCLVMYVILRHTKMKTATNIYIFNLALADTLVLLTLPFQGTDILLGFWPFGNALCKTVIAIDY 128
            .||.||:||:||.:||:|.|||||.|||:||...|:.:||....:.:..|.||..:||..:....
  Fly    93 FGNTLVIYVVLRFSKMQTVTNIYILNLAVADECFLIGIPFLLYTMRICSWRFGEFMCKAYMVSTS 157

  Rat   129 YNMFTSTFTLTAMSVDRYVAICHPIRALDVRTSSKAQAVNVAIWALASVVGVPVAIMGSAQVEDE 193
            ...|||:..|..||.|||:|:||||.:...||...|:.|:...|:.::|:.:||.:..|...:::
  Fly   158 ITSFTSSIFLLIMSADRYIAVCHPISSPRYRTLHIAKVVSAIAWSTSAVLMLPVILYASTVEQED 222

  Rat   194 EIECLVEIPAPQDY---WGPVFAICIFLFSFIIPVLIISVCYSLMIRRLRGVRLLSG--SREKDR 253
            .|.....|..|..|   .|..|.:..|...|..|:..|...|.|:||:||.|....|  |:||.|
  Fly   223 GINYSCNIMWPDAYKKHSGTTFILYTFFLGFATPLCFILSFYYLVIRKLRSVGPKPGTKSKEKRR 287

  Rat   254 NLRRITRLVLVVVAVFVGCWTP---VQVFVLVQGLGVQPGSETAVAILRFCTALGYVNSCLNPIL 315
            ..|::|||||.|::|::.||.|   .||.::......:..|...:.|.....||.|.||.:||||
  Fly   288 AHRKVTRLVLTVISVYILCWLPHWISQVALIHSNPAQRDLSRLEILIFLLLGALVYSNSAVNPIL 352

  Rat   316 YAFLDENF-KACFRKFCCAS--SLHREMQVSDRV--RSIAKDVGLGCK----TSETVPRPAXLGV 371
            ||||.||| |:.|:.|.|.:  .::.::|:...|  :..:|..| |.|    ::..:|       
  Fly   353 YAFLSENFRKSFFKAFTCMNKQDINAQLQLEPSVFTKQGSKKRG-GSKRLLTSNPQIP------- 409

  Rat   372 DLPMVPVSPQSPSTPNTELTQVTA 395
              |::|::..:.::..|..:..||
  Fly   410 --PLLPLNAGNNNSSTTTSSTTTA 431

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Oprl1NP_001305876.1 7tm_4 63..>185 CDD:304433 52/121 (43%)
7tm_1 65..316 CDD:278431 97/258 (38%)
AstC-R1NP_649040.2 7tm_4 88..368 CDD:304433 111/279 (40%)
7tm_1 94..353 CDD:278431 97/258 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24229
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X22
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.