DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gzmm and CG10041

DIOPT Version :9

Sequence 1:NP_476531.1 Gene:Gzmm / 29252 RGDID:620022 Length:264 Species:Rattus norvegicus
Sequence 2:NP_650177.2 Gene:CG10041 / 41496 FlyBaseID:FBgn0038014 Length:287 Species:Drosophila melanogaster


Alignment Length:238 Identity:78/238 - (32%)
Similarity:120/238 - (50%) Gaps:47/238 - (19%)


- Green bases have known domain annotations that are detailed below.


  Rat    39 PYMVSL-QNTK---SHVCGGVLVHQKWVLTAAHCL-SEPLQQLKLVFGLHSLHDPQDPGLTFYIK 98
            ||:||: :|.|   .|:|.||::..::||:||||: :.|.:||.:..|..||:..:.  ..|::.
  Fly    51 PYIVSIGENLKGYYKHLCVGVILSNEFVLSAAHCIQTNPTKQLYVAGGADSLNSRKQ--TRFFVV 113

  Rat    99 QAIKHPGYNLKYENDLALLKLDGRVKPSKNVKPLALPRKPRD-----------KPA--EGSRCST 150
            :...||.:.:...||:|:|::              .|:.|.|           ||.  .|::.|.
  Fly   114 ERRWHPQFRVLGGNDIAVLRI--------------YPKFPLDDVRFRSINFAGKPQRDSGTQASL 164

  Rat   151 AGWGITHQRGQLAKSLQELDLRLLDTRMCNNS-RFWNGVLTDSMLC---LKAGAKGQAPCKGDSG 211
            .|||.... |::.| |||:....::...|..| ||  ..|....:|   || |.:|  ||.||||
  Fly   165 VGWGRVGV-GKIRK-LQEMPFLTMENDECQQSHRF--VFLKPLDICAMHLK-GPRG--PCDGDSG 222

  Rat   212 GPLV-CGKGKVDGILSFSSKNCTDIFKPTVATAVAPYSSWIRK 253
            .||: ..|.|:.|:||:..|.||.: ||...|.:..|||||::
  Fly   223 APLMNVAKEKLYGLLSYGRKACTPL-KPYAFTRINAYSSWIQE 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GzmmNP_476531.1 Tryp_SPc 27..254 CDD:238113 78/238 (33%)
Trypsin 27..251 CDD:278516 76/234 (32%)
CG10041NP_650177.2 Tryp_SPc 49..264 CDD:238113 78/236 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.