DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment F10 and CG11836

DIOPT Version :9

Sequence 1:NP_058839.1 Gene:F10 / 29243 RGDID:61850 Length:482 Species:Rattus norvegicus
Sequence 2:NP_001356925.1 Gene:CG11836 / 43007 FlyBaseID:FBgn0039272 Length:333 Species:Drosophila melanogaster


Alignment Length:275 Identity:100/275 - (36%)
Similarity:151/275 - (54%) Gaps:29/275 - (10%)


- Green bases have known domain annotations that are detailed below.


  Rat   212 SELLNLNKTEPEAN----------------SDDVIRIVGGQECKRGECPWQALLFSDEETDGFCG 260
            |....|:.||.|..                |::.||||||:.....:.||.|.:..|.:.  .||
  Fly    61 SNAFGLSDTEDEVEYTENSSLKNCDCDCGFSNEEIRIVGGKPTGVNQYPWMARIVYDGKF--HCG 123

  Rat   261 GTILNEFYILTAAHCLHQAKRFKVRV--GDLNTEQEDGGEMVHE-VDMIIKHNKFQRDTYDFDIA 322
            |::|.:.|:|:||||:.:.::.|:||  ||.:.|.....:.:.. |..:|||..|..|||:.|||
  Fly   124 GSLLTKDYVLSAAHCVKKLRKSKIRVIFGDHDQEITSESQAIQRAVTAVIKHKSFDPDTYNNDIA 188

  Rat   323 MLRLKTPITFRENVAPACLPQKDWAEATLMTQKTGIVSGFGRTHEKGRQSKVLKMMEVPYVDRNT 387
            :|||:.||:|.:.:.|.|||:.::..|    .:.|.|.|:|||.|.|....::..::||.:....
  Fly   189 LLRLRKPISFSKIIKPICLPRYNYDPA----GRIGTVVGWGRTSEGGELPSIVNQVKVPIMSITE 249

  Rat   388 CRLS--TSFSITQNMFCAGYDAKQEDACQGDSGGPHVTRFKDTYFVTGIVSWGEGCARKGKYGIY 450
            ||..  .|..||.:|.|||..:.  |:||||||||.:......||:.||||||.||.|:|..|:|
  Fly   250 CRNQRYKSTRITSSMLCAGRPSM--DSCQGDSGGPLLLSNGVKYFIVGIVSWGVGCGREGYPGVY 312

  Rat   451 TKVTAFLKWIDRSMK 465
            ::|:.|:.||..:::
  Fly   313 SRVSKFIPWIKSNLE 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
F10NP_058839.1 GLA 23..84 CDD:214503
EGF_CA 86..122 CDD:238011
FXa_inhibition 129..164 CDD:405372
Tryp_SPc 232..462 CDD:238113 92/234 (39%)
CG11836NP_001356925.1 Tryp_SPc 97..325 CDD:238113 92/235 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 166 1.000 Domainoid score I3777
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H30976
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm12321
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X11
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.910

Return to query results.
Submit another query.