DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PDIA3 and CaBP1

DIOPT Version :9

Sequence 1:NP_005304.3 Gene:PDIA3 / 2923 HGNCID:4606 Length:505 Species:Homo sapiens
Sequence 2:NP_001285979.1 Gene:CaBP1 / 34976 FlyBaseID:FBgn0025678 Length:433 Species:Drosophila melanogaster


Alignment Length:497 Identity:106/497 - (21%)
Similarity:168/497 - (33%) Gaps:238/497 - (47%)


- Green bases have known domain annotations that are detailed below.


Human     3 LRRLALFPGVALLLA------AARLAAASDVLELTDDNFESRISDTGSAGLMLVEFFAPWCGHCK 61
            :|:||..    ||||      :|..:.:..|:|||..||:..:....:  :.:|||:|||||||:
  Fly     1 MRQLASI----LLLAFVVGSVSAFYSPSDGVVELTPSNFDREVLKDDA--IWVVEFYAPWCGHCQ 59

Human    62 RLAPEYEAAATRLKGIVPLAKVDCTANTNTCNKYGVSGYPTLKIFRDGEEAGA-YDGPRTADGIV 125
            .|.|||:..|..|||:|.:..|:..|::....::||.|:||:|||...:::.. |:|.|||..|.
  Fly    60 SLVPEYKKLAKALKGVVKVGSVNADADSTLSGQFGVRGFPTIKIFGANKKSPTDYNGQRTAKAIA 124

Human   126 SHLKKQAGPASVPLRTEEEFKKFISDKDASIVGFFDDSFSEAHSEFLKAASNLRDNYRFAHTNVE 190
                                       :|::                                  
  Fly   125 ---------------------------EAAL---------------------------------- 128

Human   191 SLVNEYDDNGEGIILFRPSHLTNKFEDKTVAYTEQKMTSGKIKKFIQENIFGICPHMTEDNKDLI 255
                                                   .::||.:|..:.|             
  Fly   129 ---------------------------------------AEVKKKVQGVLGG------------- 141

Human   256 QGKDLLIAYYDVDYEKNAKGSNYWRNRVMMVAKKFLDAGHKLNFAVASRKTFSHELSDFGLESTA 320
                             ..||                                   |..|..|::
  Fly   142 -----------------GGGS-----------------------------------SSGGSGSSS 154

Human   321 GEIPVVAIRTAKGEKFVMQEEFSRDGKALERFLQDYFDGNLKRYLKSEPIPESNDGPVKVVVAEN 385
            |:..:               |.:.|                                       |
  Fly   155 GDDVI---------------ELTED---------------------------------------N 165

Human   386 FDEIVNNENKDVLIEFYAPWCGHCKNLEPKYKELGEKLSKDPNIVIAKMDATAN-DVPSPYEVRG 449
            ||::|.|.:...|:||:||||||||||.|::.:..::|.  ..:.:..:||||: ...:.|.|||
  Fly   166 FDKLVLNSDDIWLVEFFAPWCGHCKNLAPEWAKAAKELK--GKVKLGALDATAHQSKAAEYNVRG 228

Human   450 FPTIYFSPANKK--LNPKKYEGGRELSDFISYL-QREATNPP 488
            :|||.|.||..|  .:.::|:|||..||.:|:. .:...|.|
  Fly   229 YPTIKFFPAGSKRASDAQEYDGGRTASDIVSWASDKHVANVP 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PDIA3NP_005304.3 YbbN 25..487 CDD:331940 96/466 (21%)
ER retention motif 502..505
CaBP1NP_001285979.1 PDI_a_P5 26..119 CDD:239299 37/94 (39%)
PDI_a_P5 157..262 CDD:239299 44/160 (28%)
Thioredoxin_6 190..383 CDD:290560 29/83 (35%)
P5_C 271..400 CDD:239281 106/497 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.