DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Inhba and scw

DIOPT Version :9

Sequence 1:NP_058824.1 Gene:Inhba / 29200 RGDID:62074 Length:424 Species:Rattus norvegicus
Sequence 2:NP_001286088.1 Gene:scw / 46000 FlyBaseID:FBgn0005590 Length:400 Species:Drosophila melanogaster


Alignment Length:415 Identity:86/415 - (20%)
Similarity:156/415 - (37%) Gaps:102/415 - (24%)


- Green bases have known domain annotations that are detailed below.


  Rat    46 DGPNSQ--PEMVEAVKKHILNMLHLKKRPDVTQ-PVPKAALLNAIRKLHVGKVGENGYVEIEDDI 107
            |.|..|  |.:..:..|.:|.:.:     :::: ..||..|....::            .::|||
  Fly    50 DRPRRQAEPNLHNSASKFLLEVYN-----EISEDQEPKEVLHQRHKR------------SLDDDI 97

  Rat   108 GRRAEMNELMEQTSEIITFA-----ESGTARKTLH--FEISKEGSDLSVVERAEVWLFLKVPKAN 165
            ....|..:.:...:.|:||:     |.......:|  |..:....|||:|: |.:.:: |.|...
  Fly    98 LISNEDRQEIASCNSILTFSSRLKPEQLDNELDMHITFNTNDVPVDLSLVQ-AMLRIY-KQPSLV 160

  Rat   166 RTRTKVTIRLFQQQKHPQGSLDMGDEAEEMGLKGERSELLLSEKVVDARKSTWHIFPVSSSIQRL 230
            ..|...|:.::::..:.|                :.|..:|......:.:..|..|.::.:::..
  Fly   161 DRRANFTVSVYRKLDNRQ----------------DFSYRILGSVNTTSSQRGWLEFNLTDTLRYW 209

  Rat   231 LD----QGKSSLDVRIACEQCQESGASLV---------------------LLGKKKKKEVDGDGK 270
            |.    |.::.|.:.|...|.....|.||                     ||.|.:|.....|.:
  Fly   210 LHNKGLQRRNELRISIGDSQLSTFAAGLVTPQASRTSLEPFIVGYFNGPELLVKIQKLRFKRDLE 274

  Rat   271 KKDGSDGGLEEEKEQSHRPFLMLQARQSEDHPHRRRRRGLECDGKVNICCKKQFFVSFKDIGWND 335
            |:....|   ........|..:.:..||                    |.:..|.|.||::..::
  Fly   275 KRRAGGG---SPPPPPPPPVDLYRPPQS--------------------CERLNFTVDFKELHMHN 316

  Rat   336 WIIAPSGYHANYCEGECPSHIAGTSGSSLSFHSTV--INHYRMRGHSPFANLKSCCVPTKLRPMS 398
            |:|||..:.|.:|.|.| :...||..::.: |:.|  :.|.: :.|.|    |.|||||.|..::
  Fly   317 WVIAPKKFEAYFCGGGC-NFPLGTKMNATN-HAIVQTLMHLK-QPHLP----KPCCVPTVLGAIT 374

  Rat   399 MLYYDDGQNIIKKDIQNMIVEECGC 423
            :|.|.:...|.....|..:.:||||
  Fly   375 ILRYLNEDIIDLTKYQKAVAKECGC 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
InhbaNP_058824.1 TGFb_propeptide 56..236 CDD:413528 31/191 (16%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 264..306 6/41 (15%)
TGF_beta_INHBA 317..424 CDD:381674 35/109 (32%)
scwNP_001286088.1 TGFb_propeptide 39..254 CDD:279078 41/238 (17%)
TGFB 300..400 CDD:214556 35/107 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.