DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Chka and eas

DIOPT Version :9

Sequence 1:XP_006230769.1 Gene:Chka / 29194 RGDID:61944 Length:463 Species:Rattus norvegicus
Sequence 2:NP_523364.2 Gene:eas / 32585 FlyBaseID:FBgn0000536 Length:495 Species:Drosophila melanogaster


Alignment Length:473 Identity:116/473 - (24%)
Similarity:184/473 - (38%) Gaps:165/473 - (34%)


- Green bases have known domain annotations that are detailed below.


  Rat    78 QPEPRTRRRAYLWCKEFLP------GAWRGLRE---------DQFHISV--IRGGLSNMLFQCSL 125
            :||.::|:.|.:   .|:|      ...:|.:|         |..|:..  ...|::|.|..| .
  Fly    83 KPEDKSRKEAIV---PFVPIFVEEADVIQGAKELLKVIRPTWDLSHVEFKSFTDGITNKLVGC-F 143

  Rat   126 PDSIASVGDE------PRK-----------------------------------------VLLRL 143
            ...|:.:.||      |.|                                         ||:|:
  Fly   144 HKEISKLNDENGGSYLPIKTQGLSPVQSEDPVIIEKEDDDEFTDDRAADDGSPVQYSDNVVLVRI 208

  Rat   144 YGAILKMVFLIKLWNGKRSCNKEGSEQAQNENEFQGAEAMVLESVMFAILAERSLGPKLYGIFPQ 208
            ||.  |...||             ..:|:.:|              |.:|....|.|.||..|..
  Fly   209 YGN--KTDLLI-------------DRKAETQN--------------FLLLHTYGLAPSLYATFKN 244

  Rat   209 GRLEQFIPSRRLDTEELCLPDISAEIAEKMATFH-------------GMKMPFNKEPKWLFGTME 260
            |.:.:::|...|:|:.:..|:|...:|.:||..|             .|.|.:.|...:|....|
  Fly   245 GLVYEYVPGTTLNTDSVLCPEIWPLVARRMAEMHRKVRKHGDSSATKPMPMIWKKTQSFLDLVPE 309

  Rat   261 KYLNQVLRLKFSREARVQQLHKFLSYNLPL-----ELENLRSLLQYTRSPVVFCHNDCQEGNILL 320
            ::.:.      .:..||::..      ||:     |...|...|:...||:||.|||...||::.
  Fly   310 RFSDA------EKHKRVKETF------LPIGRLREEFNKLYEYLEALDSPIVFSHNDLLLGNVIY 362

  Rat   321 LEGQENSEKQKLMLIDFEYSSYNYRGFDIGNHFCEWM----YDYTYEKYPFFRANIQKYPTRKQQ 381
            .:....     :..||:||:.||::.|||||||.|..    .||:            :||.|:.|
  Fly   363 TQSLNT-----VNFIDYEYADYNFQAFDIGNHFAEMCGVDEVDYS------------RYPKREFQ 410

  Rat   382 LHFISSYL------TTFQNDFESLSSEEQSATKEDMLLEVNRFALASHFLWGLWSIVQAKISSIE 440
            |.::..||      :..|||...|           :.::||:||||||..|.:||::||:.|:|:
  Fly   411 LQWLRVYLEEYLQRSNIQNDEVEL-----------LYVQVNQFALASHIFWTVWSLLQAEHSTID 464

  Rat   441 FGYMEYAQARFDAYFDQK 458
            |.|:.||..|::.|..:|
  Fly   465 FDYVGYAFLRYNEYLARK 482

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ChkaXP_006230769.1 PLN02236 95..461 CDD:177880 111/456 (24%)
ChoK_euk 107..458 CDD:270705 106/427 (25%)
easNP_523364.2 ETNK_euk 126..478 CDD:270706 104/421 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000493
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.