DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fdx1 and Fdx1

DIOPT Version :9

Sequence 1:NP_058822.2 Gene:Fdx1 / 29189 RGDID:62036 Length:188 Species:Rattus norvegicus
Sequence 2:NP_001189075.1 Gene:Fdx1 / 39070 FlyBaseID:FBgn0011769 Length:172 Species:Drosophila melanogaster


Alignment Length:153 Identity:51/153 - (33%)
Similarity:89/153 - (58%) Gaps:11/153 - (7%)


- Green bases have known domain annotations that are detailed below.


  Rat    24 CRRLLVCGTRAGPAIPQWTP--SPHTLAEAGPGRPLSVSARARSSSEDKVTVHFKNRDGETLTTK 86
            |:  |:....|.||.  :||  :.||..   |.|......:...|:::.|.:.:.::||:....:
  Fly    15 CK--LISKQIAKPAF--YTPHNALHTTI---PRRHGEFEWQDPKSTDEIVNITYVDKDGKRTKVQ 72

  Rat    87 GKVGDSLLDVVIENNLDIDGFGACEGTLACSTCHLIFEDHIYEKLDAITDEENDMLDLAFGLTNR 151
            |||||::|.:...:.::::  ||||.:|||:|||:..:....:||....::|:|:||:|..|...
  Fly    73 GKVGDNVLYLAHRHGIEME--GACEASLACTTCHVYVQHDYLQKLKEAEEQEDDLLDMAPFLREN 135

  Rat   152 SRLGCQVCLTKAMDNMTVRVPEA 174
            ||||||:.|.|:|:.|.:.:|:|
  Fly   136 SRLGCQILLDKSMEGMELELPKA 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fdx1NP_058822.2 fer2 71..174 CDD:412190 38/102 (37%)
Fdx1NP_001189075.1 PLN02593 57..172 CDD:178203 40/109 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0633
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1380051at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100695
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.720

Return to query results.
Submit another query.