DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cd63 and Tsp42Er

DIOPT Version :9

Sequence 1:XP_008763246.1 Gene:Cd63 / 29186 RGDID:62080 Length:262 Species:Rattus norvegicus
Sequence 2:NP_523644.1 Gene:Tsp42Er / 35629 FlyBaseID:FBgn0033139 Length:211 Species:Drosophila melanogaster


Alignment Length:236 Identity:66/236 - (27%)
Similarity:104/236 - (44%) Gaps:53/236 - (22%)


- Green bases have known domain annotations that are detailed below.


  Rat    38 LYVLLLAFC---ACAVGLIAIGVAVQVVLKQAITHETTAGSLLPVVIIAVGAFLFLVAFVGCCGA 99
            |.:..|||.   .|||    :|:|..||...||........|:..:.||||:.:||::|.||.||
  Fly     6 LMIRYLAFLFNFLCAV----LGIATIVVNVIAIDQIAPKDQLILGLYIAVGSIVFLLSFFGCFGA 66

  Rat   100 CKENYCLMITFAIFLSLIMLVEVAVAIAGYVFRDQVKSEFSKSFQKQMQNYLTDNKTATILDKLQ 164
            .||:.|  :|:|...|:::::.|::.:. :|||...:.:   |..|..|.:.....|...:.:.|
  Fly    67 IKESIC--VTWAYATSMLVMLIVSIVML-FVFRMHFEED---SITKLKQAFAKQTNTFDAMAEYQ 125

  Rat   165 KENKCCGASNYTDWERIPGMAKDRVPDSCCINITVGCGNDFKESTIHTQGC---VET-------- 218
            .:.:|||.....|:    |.|...||.||...      ||    |.:..||   :||        
  Fly   126 TQYQCCGIYKLKDY----GDAYITVPSSCYDQ------ND----TPYRDGCLAKMETQYEELLKG 176

  Rat   219 --IAAWLRKNVLLVAGAALGIAFVEVLGIIFSCCLVKSIRS 257
              |..|:    |:|         :|:....||..:..|:|:
  Fly   177 PKIVGWM----LMV---------IEIGAFTFSTIMGVSLRN 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cd63XP_008763246.1 Tetraspannin 33..255 CDD:278750 64/232 (28%)
ATP-synt_A <72..131 CDD:294288 19/58 (33%)
CD63_LEL 129..227 CDD:239419 27/110 (25%)
Tsp42ErNP_523644.1 Tetraspannin 8..195 CDD:278750 61/223 (27%)
tetraspanin_LEL 93..174 CDD:239401 25/97 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.