DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cd63 and Tsp39D

DIOPT Version :9

Sequence 1:XP_008763246.1 Gene:Cd63 / 29186 RGDID:62080 Length:262 Species:Rattus norvegicus
Sequence 2:NP_523612.3 Gene:Tsp39D / 35405 FlyBaseID:FBgn0032943 Length:235 Species:Drosophila melanogaster


Alignment Length:242 Identity:78/242 - (32%)
Similarity:126/242 - (52%) Gaps:22/242 - (9%)


- Green bases have known domain annotations that are detailed below.


  Rat    29 GGMKCVKFLLYVLLLAFCACAVGLIAIGVAVQVVLKQ----AITHETTAGSLLPVVIIAVGAFLF 89
            ||:.|||:|.:...|.|....:.:..:|..||:....    ...|..||    |::::.|||.:.
  Fly     4 GGLTCVKYLTFFCNLLFALTGLLIFLVGGMVQLNYAHYSNFVSDHVWTA----PIILMIVGAAVA 64

  Rat    90 LVAFVGCCGACKENYCLMITFAIFLSLIMLVEVAVAIAGYVFRDQVKSEFSKSFQKQMQNY--LT 152
            ::.|:|||||.||:.|::::||:...:|.|.|:.:.:||||....:.......|...||:|  ..
  Fly    65 VICFLGCCGALKESSCMILSFALLAVVIFLFEIGLGLAGYVKHTGLHQIMESQFNSTMQHYKERA 129

  Rat   153 DNKTATILDKLQKENKCCGASNYTDWERIPGMAKDRVPDSCC--INITVG--CGNDFKESTIHTQ 213
            |.:.|..|  ||.|..|||.:...|||.:  .....:|.:||  ||::..  |.|  ..:|.|  
  Fly   130 DYRDAWTL--LQTELDCCGINGPNDWETV--YRNSTLPAACCSVINLSEAKECTN--THATQH-- 186

  Rat   214 GCVETIAAWLRKNVLLVAGAALGIAFVEVLGIIFSCCLVKSIRSGYE 260
            ||::.:...|....|::|...||:|.:::|.|:|:|||.:|.|..|:
  Fly   187 GCLQKLLEILDSKTLILASVVLGVAGIQMLTILFACCLYRSFRRSYD 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cd63XP_008763246.1 Tetraspannin 33..255 CDD:278750 73/231 (32%)
ATP-synt_A <72..131 CDD:294288 23/58 (40%)
CD63_LEL 129..227 CDD:239419 30/103 (29%)
Tsp39DNP_523612.3 Tetraspannin 8..227 CDD:278750 73/230 (32%)
tetraspanin_LEL 104..200 CDD:239401 30/103 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1467737at2759
OrthoFinder 1 1.000 - - FOG0005733
OrthoInspector 1 1.000 - - mtm8982
orthoMCL 1 0.900 - - OOG6_106877
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3621
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.720

Return to query results.
Submit another query.