DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cd37 and Tsp74F

DIOPT Version :9

Sequence 1:XP_017444339.1 Gene:Cd37 / 29185 RGDID:62035 Length:396 Species:Rattus norvegicus
Sequence 2:NP_524132.1 Gene:Tsp74F / 39995 FlyBaseID:FBgn0036769 Length:236 Species:Drosophila melanogaster


Alignment Length:271 Identity:73/271 - (26%)
Similarity:124/271 - (45%) Gaps:53/271 - (19%)


- Green bases have known domain annotations that are detailed below.


  Rat    25 SAQESCLSLIKYFLFVFNLFFFVLGGLIFCFGTWILIDKTSFVS-------FVGLSFVPLQTWSK 82
            |..:.|...:||.||:.|...||.|.::||...|.|:|: |||:       |.|..:        
  Fly     5 SRMDCCGQFVKYSLFIANFVIFVGGAIVFCLTLWTLVDR-SFVNELLGTNLFSGAVY-------- 60

  Rat    83 VLSVSGVLTMALALLGCVGALKELRCLLGLYFGMLLLLFATQITLGILISTQRVRLERRVQELVL 147
            ||.|:.::...::.||||||.||::|||..||.::.|:|.|.:..|:|....|.|:::.:::.:.
  Fly    61 VLLVTSIIICLVSFLGCVGAGKEVKCLLLTYFIIVALVFVTMLIGGVLGYVFRERVQQTMRQEMR 125

  Rat   148 RTIQSYRTNPDETAAEESWDYAQFQLRCCGWQSPRDWNKAQMLKANGSEELFVPCSCYNSTATND 212
            .|:..|.:..:.|   ::||..|.:|:|||..:..|||:...:..:..:|||             
  Fly   126 STMALYGSRREIT---QAWDLTQERLQCCGVDTWHDWNRYGPVPESCCQELF------------- 174

  Rat   213 SSGFDKLFLSQLSRLGPRAKLRQTADICALPAKAHIYREGCARSLQKWLHNNIISIVGICLGVGL 277
             .|                   |..:....|...::|.:||......::.::...|.|..:.|.:
  Fly   175 -GG-------------------QRKECTIFPTITNLYNQGCLYVTTNFIRDHAAVIGGTSIAVAI 219

  Rat   278 LEVSGMAL-CL 287
            |.:.||.. ||
  Fly   220 LMIFGMIFSCL 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cd37XP_017444339.1 None
Tsp74FNP_524132.1 Tetraspannin 14..231 CDD:395265 71/262 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19282
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.